Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
C1QA goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | The subunit C1q is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization. |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
Rabbit polyclonal C1QC Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC. |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
C3 rabbit polyclonal antibody, Serum
| Applications | ID, IHC, IP |
| Reactivities | Human |
| Immunogen | C3c is the major fragment resulting from the C3 cleavage by C3 convertase and factor i. It is composed of an intact beta chain bound to two fragments of the alpha chain. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
USD 590.00
5 Days
Complement Component 6 (C6) mouse monoclonal antibody, clone 056B-214.2.4.2, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
IL10 mouse monoclonal antibody, clone BN-10, FITC
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | FITC |
IL10 mouse monoclonal antibody, clone BN-10, PE
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE |
C1QC rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL |
Rabbit Polyclonal Anti-C1QB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD |
Active filters
Applications
- IHC
Families
- Secreted Protein
Pathways
- Systemic lupus erythematosus