Rabbit anti-HSPA9 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPA9 |
Rabbit anti-HSPA9 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPA9 |
Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
Rabbit Polyclonal Anti-WDR61 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | WDR61 antibody was raised against a 14 amino acid peptide near the amino terminus of human WDR61. |
Rabbit Polyclonal Anti-SLC1A7 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SLC1A7 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human SLC1A7. |
Rabbit Polyclonal Anti-WNT5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | WNT5 antibody was raised against a 15 amino acid peptide near the center of human WNT5B. |
Rabbit anti-HSPD1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPD1 |
Mouse monoclonal Hsp60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Hamster, Monkey, Pig, Rabbit, Spinach, E.coli (GroEl), H. pylori, S. typhimurium, T. spiralis, yeast, white fly |
Conjugation | Unconjugated |
Rabbit anti-MTR4 Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MTR4 |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit polyclonal anti-NSE / ENO2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human NSE. |
Rabbit polyclonal anti-HSP60 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human HSP60. |
Hsp60 (HSPD1) rabbit polyclonal antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Hsp60 (HSPD1) rabbit polyclonal antibody
Applications | FC, IF, IHC, WB |
Reactivities | Mouse, Primate, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to ENO1 (enolase 1, (alpha))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 199 and 434 of ENO1 (Uniprot ID#P06733) |
Rabbit polyclonal CAF-1 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1. |
Rabbit polyclonal CNOT8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CNOT8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from the C-terminal region of human CNOT8. |
Rabbit polyclonal ENO1 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal Exosome Component 9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human EXOSC9 protein (within residues 250-439). [Swiss-Prot Q06265] |
Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-PNPT1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PNPT1. |
Rabbit Polyclonal DIS3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DIS3 antibody was raised against an 18 amino acid peptide near the amino terminus of human DIS3. |
Rabbit polyclonal HSPD1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit Polyclonal anti-HSPA9 antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
Rabbit polyclonal anti-XRN2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human XRN2. |
Mouse monoclonal Hsp60 Antibody
Applications | IHC, WB |
Reactivities | Bovine, Canine, Chicken, Drosophila, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig |
Conjugation | Unconjugated |
Rabbit Polyclonal CNOT4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Xenopus |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 50-100 of human CNOT4 was used as the immunogen for the antibody. |
Carrier-free (BSA/glycerol-free) HSPA9 mouse monoclonal antibody, clone OTI9F8 (formerly 9F8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LSM1 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EXOSC7 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCPS mouse monoclonal antibody,clone OTI1E6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCPS mouse monoclonal antibody,clone OTI4H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI4E4
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI3A2
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI3G1
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI6F7
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI6F11
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI1G5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4C9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI2D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |