Primary Antibodies

View as table Download

PPP3CA Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP3CA

Rabbit anti-PTPN6 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PTPN6

SHP1 (PTPN6) mouse monoclonal antibody, clone PTY11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

SHP1 (PTPN6) mouse monoclonal antibody, clone PTY15, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

PPP3R2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 9~29 amino acids from the N-terminal region of Human PPP3R2 / CBLP

Goat Polyclonal Antibody against PTPN6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTKNKREEKVKKQ, from the internal region (near the C Terminus) of the protein sequence according to NP_536858.1; NP_002822.2.

Rabbit polyclonal SHP-1 (Phospho-Tyr564) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SHP-1 around the phosphorylation site of tyrosine 564 (D-V-YP-E-N).
Modifications Phospho-specific

Rabbit Polyclonal Phospho-SHP-1 (Tyr536) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyrosine 536
Modifications Phospho-specific

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS

SHP1 (PTPN6) mouse monoclonal antibody, clone 14D5, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit Polyclonal SHP-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SHP-1

Calcineurin A (PPP3CA) mouse monoclonal antibody, clone CC-6, Aff - Purified

Applications IHC, WB
Reactivities Human, Rat

Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH

Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A purified peptide conjugated to KLH

DAPP1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

Calcineurin A (PPP3CA) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of human Calcineurin (PPP3CA).

PPP3CC (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen kLH conjugated synthetic peptide selected from the N-terminal region of Human PPP3CC. 
Epitope: N-Terminus.

PPP3CC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 17-45 amino acids from the N-terminal region of Human PPP3CC

Rabbit polyclonal anti-Calcineurin A antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A

Mouse Monoclonal SHP-1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Goat Polyclonal Antibody against PTPN6 (Internal Region)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KASRTSSKHKEE, from the internal region of the protein sequence according to NP_536858.1; NP_002822.2.

Goat Anti-DAPP1 / BAM32 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KLSQIRKQLNQGE, from the internal region (near C Terminus) of the protein sequence according to NP_055210.2.

Rabbit Polyclonal Anti-DAPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAPP1 antibody: synthetic peptide directed towards the middle region of human DAPP1. Synthetic peptide located within the following region: SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG

Rabbit Polyclonal Anti-DAPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAPP1 antibody: synthetic peptide directed towards the middle region of human DAPP1. Synthetic peptide located within the following region: KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDD

Rabbit polyclonal Anti-PPP3R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3R1 antibody: synthetic peptide directed towards the N terminal of human PPP3R1. Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the middle region of human PPP3CA. Synthetic peptide located within the following region: LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE

Carrier-free (BSA/glycerol-free) PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DAPP1 mouse monoclonal antibody,clone OTI7A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DAPP1 mouse monoclonal antibody,clone OTI1C10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DAPP1 mouse monoclonal antibody,clone OTI2B5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DAPP1 mouse monoclonal antibody,clone OTI7D4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP3CA mouse monoclonal antibody,clone OTI5C6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PTPN6 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6

Rabbit Polyclonal Anti-PPP3CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP3CA

PPP3CC Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DAPP1 mouse monoclonal antibody,clone OTI7A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DAPP1 mouse monoclonal antibody,clone OTI7A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DAPP1 mouse monoclonal antibody,clone OTI1C10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DAPP1 mouse monoclonal antibody,clone OTI1C10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated