Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Goat Polyclonal Anti-AIFM1 (aa183-195) Antibody
| Applications | IF, WB |
| Reactivities | Human (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AIFM1 (aa183-195) Antibody: Peptide with sequence C-DDPNVTKTLRFKQ, from the internal region of the protein sequence according to NP_004199.1; NP_665811.1; NP_001124319.1. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Rabbit Polyclonal Antibody against MAP3K5 (S83)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASK1(MEKK5/MAP3K5) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 61-90 amino acids from human ASK1(MEKK5/MAP3K5). |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
Rabbit Polyclonal ASK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ASK1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ASK1. |
Rabbit polyclonal Filamin A (Ser2152) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Filamin A around the phosphorylation site of serine 2152 (A-P-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-MAP4K3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human MAP4K3. |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal FGFR4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGFR4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-55 amino acids from the N-terminal region of human FGFR4. |
Rabbit Polyclonal Trk B (Tyr515) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk B around the phosphorylation site of Tyrosine 515 (peptide seq 509-521aa: VIENPQY(p)FGITN) |
| Modifications | Phospho-specific |
Rabbit Polyclonal Stathmin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Stathmin 1 |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
ATF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF4 |
Active filters
Applications
- WB
Pathways
- MAPK signaling pathway
Filter by
Target Symbol
- TP53 (243)
- MAP2K1 (222)
- JUN (173)
- MAP2K3 (157)
- EGFR (156)
- GADD45G (132)
- AKT1 (116)
- MAPK13 (99)
- BRAF (92)
- FGF21 (71)
- MAPK1 (68)
- MAPT (61)
- MEF2C (60)
- KRAS (58)
- MAPK7 (57)
- PDGFRA (57)
- MAPKAPK5 (55)
- MAPK8 (54)
- FOS (52)
- PPP5C (52)
- HSPA1A (51)
- FGFR2 (50)
- MYC (50)
- PPM1B (46)
- CASP3 (45)
- HRAS (45)
- HSPB1 (42)
- RPS6KA2 (42)
- MAPK14 (41)
- PDGFRB (41)
- RASGRP3 (40)
- RELA (40)
- AKT2 (39)
- IKBKG (39)
- FGFR1 (38)
- TNF (38)
- DDIT3 (36)
- MAP2K4 (35)
- MAP2K2 (33)
- DUSP5 (32)
- IL1A (32)
- MAPK9 (31)
- CD14 (29)
- RAF1 (29)
- CHP1 (28)
- NFKB1 (28)
- HSPA1L (27)
- FGF2 (26)
- PRKCA (26)
- ATF4 (25)
- DUSP1 (25)
- EGF (24)
- NTF3 (24)
- DUSP10 (23)
- MAPK8IP1 (23)
- ARRB1 (22)
- HSPA6 (22)
- MAP3K8 (22)
- MAPK3 (22)
- RASA1 (21)
- STMN1 (20)
- ATF2 (19)
- CDC25B (19)
- MAPK10 (19)
- CHUK (18)
- PAK1 (18)
- TGFB1 (18)
- TGFBR2 (18)
- AKT3 (17)
- CACNB2 (17)
- FAS (17)
- IL1B (17)
- MAP3K5 (17)
- MAP3K7 (17)
- MAX (17)
- PLA2G3 (17)
- PTPN7 (17)
- HSPA8 (16)
- NRAS (16)
- DUSP4 (15)
- NTRK2 (15)
- GADD45A (14)
- NTF4 (14)
- FGF13 (13)
- FGFR3 (13)
- PPP3CA (13)
- RPS6KA1 (13)
- STK3 (13)
- CACNB1 (12)
- IKBKB (12)
- MAP3K13 (12)
- PLA2G6 (12)
- PRKCB (12)
- FGF4 (11)
- PDGFB (11)
- RELB (11)
- GRB2 (10)
- MAPKAPK2 (10)
- NFKB2 (10)
- NTRK1 (10)
Reactivities
- Human (4112)
- Mouse (3296)
- Rat (3109)
- Dog (606)
- Monkey (588)
- Bovine (48)
- Pig (37)
- Chicken (34)
- Cow (22)
- Xenopus (17)
- Hamster (15)
- Rabbit (15)
- Rhesus Monkey (12)
- Drosophila (10)
- Canine (9)
- Sheep (9)
- Fish (7)
- Guinea Pig (7)
- Primate (7)
- X. tropicalis (7)
- C. elegans (5)
- Yeast (5)
- Zebrafish (5)
- Beluga (4)
- Amphibian (3)
- Chimpanzee (3)
- Feline (3)
- Fruit fly (3)
- Saccharomyces cerevisiae (3)
- Canis (2)
- Carp (2)
- Equine (2)
- Coral (1)
- Dogfish (1)
- Hagfish (1)
- Macaque (1)
- Plant (1)
- Porcine (1)
- Tobacco (1)
- Tobacco hornworm (1)
- Tomato (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (3846)
- Protein Kinase (1967)
- Transcription Factors (1202)
- ES Cell Differentiation/IPS (967)
- Secreted Protein (601)
- Transmembrane (596)
- Stem cell - Pluripotency (393)
- Adult stem cells (307)
- Phosphatase (239)
- Stem cell relevant signaling - JAK/STAT signaling pathway (206)
- Embryonic stem cells (201)
- Cancer stem cells (156)
- Induced pluripotent stem cells (93)
- Stem cell relevant signaling - Wnt Signaling pathway (61)
- Ion Channels: Other (59)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (50)
- Protease (45)
- Ion Channels: Calcium (9)
- Nuclear Hormone Receptor (9)