MCHR (MCHR1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 396-422 amino acids from the C-terminal region of Human MCHR1 / GPR24 |
MCHR (MCHR1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 396-422 amino acids from the C-terminal region of Human MCHR1 / GPR24 |
Goat Anti-P2RX7 / P2X7 receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence YETNKVTRIQSMNY-C, from the N-Terminus of the protein sequence according to NP_002553.2. |
Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to a region within amino acids 2 and 96 of Apelin Receptor (Uniprot ID#P35414) |
Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726) |
Goat Anti-S1PR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NYTKETLETQ, from the internal region of the protein sequence according to NP_004221.3. |
Rabbit polyclonal anti-S1PR1/EDG1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EDG1. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-PE2R3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PE2R3. |
Rabbit polyclonal anti-EDNRA antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EDNRA. |
Rabbit Polyclonal GluR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR2 |
Rabbit Polyclonal Anti-Human FPR2/ALX (extracellular)
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide (C)GGTPEERLKVAIT, corresponding to amino acid residues 184-196 of human FPR2/ALX . 2nd extracellular loop. |
Rabbit polyclonal Anti-VPAC1 (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)EEAQLENETIG(S)SK, corresponding to amino acid residues 52-65 of human VPAC1 (Accession P32241). Extracellular, N-terminus. |
Rabbit anti-CHRM5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Anti-TSHR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
Rabbit Polyclonal Anti-NTSR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT |
Goat Polyclonal Anti-ADRA1B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ADRA1B Antibody: Peptide with sequence C-SSTKAKGHNPRSS, from the internal region of the protein sequence according to NP_000670.1. |
Rabbit Polyclonal Anti-CHRM1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRM1 |
Rabbit Polyclonal Endothelin B Receptor Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, R, WB |
Reactivities | Bovine, Deer, Goat, Human, Sheep |
Immunogen | Bovine Luteinizing Hormone |
Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Human |
Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
PBR (TSPO) (156-169) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from C-term of human TSPO |
Goat Polyclonal Antibody against CRHR1
Applications | IF, WB |
Reactivities | Human, Mouse |
Immunogen | Peptide with sequence C-NEEKKSKVHYH, from the internal region of the protein sequence according to NP_004373.2. |
Rabbit Polyclonal Grik1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Grik1 antibody was raised against a 16 amino acid peptide near the center of the human Grik1. |
Rabbit Polyclonal Grik4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Grik4 antibody was raised against a 14 amino acid peptide near the amino terminus of the human Grik4. |
Rabbit Polyclonal Grik5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Grik5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human Grik5. |
Rabbit polyclonal antibody to Adenosine A2A-R (adenosine A2a receptor)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 338 and 412 of Adenosine A2a Receptor (Uniprot ID#P29274) |
Mouse Monoclonal anti-NR2B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse anti-GnRHR monoclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-BDKRB1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BDKRB1. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-EDNRA antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EDNRA. |
Rabbit polyclonal anti-OPRM1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OPRM1. |
Rabbit anti-CHRM1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRM1 |
Rabbit Polyclonal Anti-A1 Adenosine Receptor
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KKVSASSGDPQKYYGKE, corresponding to amino acid residues 213-229 of human A1AR. 3rd intracellular loop. |
Rabbit anti-GRIA1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIA1 |
Rabbit Polyclonal Anti-TSHR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR. Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS |
Rabbit Polyclonal Placental Lactogen Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Prolactin Receptor Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
NPY1R rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 225-270 of Human NPY1-R. |
Metabotropic Glutamate Receptor 7 (GRM7) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 860-918 of Human mGluR-7. |
EDG2 (LPAR1) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
GHRHR (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide from Human GHRHR. Epitope: C-Terminus. |
NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A. |
Leptin (LEP) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 7-37 amino acids from the N-terminal region of Human Leptin. |
Goat Polyclonal Antibody against MC2R
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence ENINNTARNNSDC, from the N Terminus of the protein sequence according to NP_000520.1. |
Goat Anti-F2R / PAR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2. |
Rabbit Polyclonal NK3R Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | NK3R antibody was raised against a 18 amino acid peptide from near the center of human NK3R. |
Rabbit Polyclonal AGTR2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AGTR2 antibody was raised against a 16 amino acid peptide from near the center of human AGTR2. |
Rabbit Polyclonal antibody to Galanin Receptor 2 (galanin receptor 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 212 and 307 of Galanin Receptor 2 (Uniprot ID#O43603) |
Rabbit Polyclonal antibody to Histamine H2 Receptor (histamine receptor H2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histamine H2 Receptor (Uniprot ID#P25021) |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Mouse Monoclonal Thrombin Receptor Antibody (N2-11)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |