Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Goat Anti-P2RX7 / P2X7 receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence YETNKVTRIQSMNY-C, from the N-Terminus of the protein sequence according to NP_002553.2. |
Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726) |
Goat Anti-S1PR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NYTKETLETQ, from the internal region of the protein sequence according to NP_004221.3. |
Rabbit Polyclonal GluR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR2 |
Rabbit polyclonal Anti-VPAC1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)EEAQLENETIG(S)SK, corresponding to amino acid residues 52-65 of human VPAC1 (Accession P32241). Extracellular, N-terminus. |
Rabbit anti-CHRM5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
Rabbit Polyclonal Anti-NTSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT |
Goat Polyclonal Anti-ADRA1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADRA1B Antibody: Peptide with sequence C-SSTKAKGHNPRSS, from the internal region of the protein sequence according to NP_000670.1. |
Rabbit Polyclonal Anti-CHRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRM1 |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Immunogen | Bovine Luteinizing Hormone |
Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Mouse anti-GnRHR monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
Rabbit anti-GRIA1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIA1 |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR. Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS |
NPY1R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 225-270 of Human NPY1-R. |
Goat Polyclonal Antibody against MC2R
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ENINNTARNNSDC, from the N Terminus of the protein sequence according to NP_000520.1. |
Rabbit Polyclonal antibody to Histamine H2 Receptor (histamine receptor H2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histamine H2 Receptor (Uniprot ID#P25021) |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Active filters
Applications
- WB
Pathways
- Neuroactive ligand-receptor interaction
Filter by
Target Symbol
- NR3C1 (67)
- FSHB (47)
- THRA (43)
- CSH1 (39)
- PRL (33)
- GABRA5 (22)
- GPR83 (19)
- F2 (17)
- GRIN2B (14)
- GRIA1 (12)
- THRB (12)
- F2R (11)
- P2RX2 (11)
- SSTR3 (11)
- CRHR2 (10)
- GH2 (10)
- GRIN1 (10)
- PLG (10)
- ADRA1B (9)
- ADRB2 (9)
- LPAR1 (9)
- GRIA2 (8)
- P2RY2 (8)
- ADORA2A (7)
- CHRM1 (7)
- GABRB1 (7)
- GRIK1 (7)
- GRIN2A (7)
- GRM3 (7)
- GRM4 (7)
- HRH3 (7)
- HTR1A (7)
- HTR5A (7)
- HTR7 (7)
- NPY1R (7)
- PTGER3 (7)
- S1PR1 (7)
- SSTR1 (7)
- SSTR4 (7)
- SSTR5 (7)
- ADRA1A (6)
- ADRA2A (6)
- AGTR1 (6)
- CNR2 (6)
- DRD1 (6)
- GABBR1 (6)
- GLRA1 (6)
- GRM7 (6)
- GRM8 (6)
- HCRTR1 (6)
- HTR2C (6)
- HTR4 (6)
- LHB (6)
- LPAR4 (6)
- MC2R (6)
- NTSR1 (6)
- OPRD1 (6)
- TRPV1 (6)
- APLNR (5)
- AVPR1A (5)
- AVPR1B (5)
- BDKRB1 (5)
- CRHR1 (5)
- CTSG (5)
- CYSLTR1 (5)
- EDNRA (5)
- EDNRB (5)
- FPR1 (5)
- FPR2 (5)
- GABRG2 (5)
- GALR2 (5)
- GHRHR (5)
- GHSR (5)
- GIPR (5)
- GRIK4 (5)
- GRM6 (5)
- HRH2 (5)
- LEP (5)
- MC1R (5)
- MTNR1A (5)
- OPRM1 (5)
- P2RX7 (5)
- PRLR (5)
- PTGER2 (5)
- S1PR3 (5)
- SSTR2 (5)
- TSHR (5)
- ADORA1 (4)
- ADRA2C (4)
- ADRB1 (4)
- BDKRB2 (4)
- BRS3 (4)
- CCKBR (4)
- CHRM5 (4)
- CNR1 (4)
- DRD4 (4)
- F2RL3 (4)
- GABBR2 (4)
- GABRA1 (4)
- GABRA3 (4)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1230)
- Transmembrane (913)
- GPCR (635)
- Secreted Protein (152)
- Transcription Factors (129)
- Nuclear Hormone Receptor (122)
- Ion Channels: Glutamate Receptors (86)
- Ion Channels: Cys-loop Receptors (84)
- Protease (37)
- Ion Channels: ATP Receptors (24)
- ES Cell Differentiation/IPS (13)
- Ion Channels: Sodium (7)
- Ion Channels: Transient receptor potential (6)