Primary Antibodies

View as table Download

OGT Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human OGT

Rabbit Polyclonal Anti-GCNT3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL

Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 223 and 502 of O-GlcNAc transferase (Uniprot ID#O15294)

Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201)

Goat Polyclonal Antibody against OGT

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-YEHPKDLKLSDGR, from the internal region of the protein sequence according to NP_858058.1; NP_858059.1.

Rabbit Polyclonal Anti-GALNT9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GALNT9 antibody is: synthetic peptide directed towards the C-terminal region of Human GALNT9. Synthetic peptide located within the following region: DFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASA

Goat Polyclonal Antibody against GCNT3 (aa 410 to 422)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NKFDPKVDDNALQ, from the internal region (near C terminus) of the protein sequence according to NP_004742.1.

Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2)

Rabbit Polyclonal Anti-GALNT10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT10 antibody: synthetic peptide directed towards the N terminal of human GALNT10. Synthetic peptide located within the following region: VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS

Rabbit Polyclonal GALNT10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GALNT10 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human GALNT10.

Rabbit Polyclonal GALNT10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GALNT10 antibody was raised against a 16 amino acid peptide near the amino terminus of human GALNT10.

Rabbit Polyclonal antibody to GALNT2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 55 and 369 of GALNT2 (Uniprot ID#Q10471)

Rabbit polyclonal anti-B4GALT5 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT5.

Rabbit Polyclonal antibody to ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 68 and 327 of ST3GAL2 (Uniprot ID#Q16842)

Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 280 of O-GlcNAc transferase (Uniprot ID#O15294)

Rabbit polyclonal C1GALT1 Antibody (Center)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This C1GALT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-144 amino acids from the Central region of human C1GALT1.

Rabbit polyclonal Anti-OGT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OGT antibody: synthetic peptide directed towards the N terminal of human OGT. Synthetic peptide located within the following region: ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE

Rabbit Polyclonal Anti-GALNT6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the N terminal of human GALNT6. Synthetic peptide located within the following region: MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP

Goat Polyclonal Antibody against GCNT3 (aa 273 to 284)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDTLHLTNKKKD, from the internal region of the protein sequence according to NP_004742.1.

Rabbit polyclonal anti-B3GNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3GNT6 antibody is: synthetic peptide directed towards the C-terminal region of Human B3GNT6. Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP

Rabbit polyclonal Anti-GALNTL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNTL4 antibody: synthetic peptide directed towards the middle region of human GALNTL4. Synthetic peptide located within the following region: IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV

Rabbit Polyclonal Anti-GALNTL6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GALNTL6 Antibody is: synthetic peptide directed towards the N-terminal region of Human GALNTL6. Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI

Rabbit Polyclonal Anti-C1GALT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1GALT1 antibody: synthetic peptide directed towards the middle region of human C1GALT1. Synthetic peptide located within the following region: NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC

Rabbit Polyclonal Anti-GALNT16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT16 antibody: synthetic peptide directed towards the N terminal of human GALNT16. Synthetic peptide located within the following region: LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLP

Rabbit Polyclonal Anti-GALNT14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT14 antibody: synthetic peptide directed towards the middle region of human GALNT14. Synthetic peptide located within the following region: LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYA

Rabbit Polyclonal Anti-ST3GAL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST3GAL2 antibody: synthetic peptide directed towards the C terminal of human ST3GAL2. Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Rabbit Polyclonal Anti-GALNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the middle region of human GALNT6. Synthetic peptide located within the following region: EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN

Rabbit Polyclonal Anti-GALNT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT5 antibody: synthetic peptide directed towards the middle region of human GALNT5. Synthetic peptide located within the following region: ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE

Rabbit Polyclonal Anti-GALNT13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT13 antibody: synthetic peptide directed towards the N terminal of human GALNT13. Synthetic peptide located within the following region: CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI

Rabbit Polyclonal Anti-GALNT15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GALNT15 antibody is: synthetic peptide directed towards the N-terminal region of Human GALNT15. Synthetic peptide located within the following region: LMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE

Rabbit Polyclonal Anti-ST6GALNAC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST6GALNAC1 antibody: synthetic peptide directed towards the middle region of human ST6GALNAC1. Synthetic peptide located within the following region: LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL

Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ST3GAL1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ST3GAL1

GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated