Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Primary Antibodies
View as table Download
ENaC Gamma Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide from human SCNN1G. |
Rabbit polyclonal SCNN1A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCNN1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-391 amino acids from the Central region of human SCNN1A. |
Goat Anti-NOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKATDIVTGLKQK, from the internal region of the protein sequence according to NP_008983.2; NP_39249.1. |
Rabbit polyclonal Anti-KCNAB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Rabbit polyclonal anti-NOX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
Rabbit polyclonal antibody to chloride channel 5 (chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 62 and 393 of CLC-5 (Uniprot ID#P51795) |
Rabbit anti-CLCN1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN1 |
Rabbit Polyclonal Anti-VDAC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |
Goat Polyclonal Anti-ASIC1 Antibody
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASIC1 Antibody: Peptide with sequence C-NILPHHPARGT, from the C Terminus of the protein sequence according to NP_064423.2; NP_001086.2; NP_001243759.1. |
VDAC1 (N-term) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VDAC1. |
Goat Anti-CLCA1 (aa872-884) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PETPSPDETSAPC, from the internal region of the protein sequence according to NP_001276.2. |
Rabbit polyclonal antibody to SCNN1A (sodium channel, nonvoltage-gated 1 alpha)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 182 and 459 of SCNN1A (Uniprot ID#P37088) |
Mouse Monoclonal anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-CLCN7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CLCN7. |
Rabbit polyclonal anti-NOX5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5. |
ENaC Gamma Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide C-SNQLTDTQMLDE from the C-terminus of human SCNN1G (NP_001030.2). Percent identity by BLAST analysis: Human, Gorilla, Marmoset (100%); Monkey (92%); Elephant (83%). |
Rabbit polyclonal CACNA2D2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal CLC4 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CLC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 663-689 amino acids from the C-terminal region of human CLC4. |
Goat Anti-CLIC1 / NCC27 (aa45-57) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TVDTKRRTETVQK, from the internal region of the protein sequence according to NP_001279.2. |
Rabbit anti-GJA4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GJA4 |
Rabbit anti-CLCN5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN5 |
Rabbit anti-BEST1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BEST1 |
Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
Active filters
Families
- Ion Channels: Other
Filter by
Category
Target Symbol
- KCNAB1 (54)
- KCTD14 (45)
- KCNIP2 (42)
- FXYD3 (40)
- BEST3 (32)
- AQP1 (21)
- KCTD13 (21)
- GJA1 (20)
- NUDT9 (19)
- CACNB2 (18)
- TOMM40L (17)
- CACNB1 (12)
- CLIC1 (10)
- CLCA1 (9)
- CYBB (7)
- TNFAIP1 (7)
- TOMM40 (7)
- VDAC2 (7)
- CLIC4 (6)
- GJB1 (6)
- KCNH6 (6)
- VDAC1 (6)
- CACNB4 (5)
- FXYD5 (5)
- GJB2 (5)
- KCNIP4 (5)
- KCNMB2 (5)
- KCNMB3 (5)
- KCTD15 (5)
- KCTD5 (5)
- NOX1 (5)
- SCNN1A (5)
- ABCC4 (4)
- ASIC1 (4)
- ASIC2 (4)
- CACNG1 (4)
- CHRFAM7A (4)
- CLCC1 (4)
- CLIC3 (4)
- CLNS1A (4)
- GJA4 (4)
- GJC1 (4)
- KCNAB2 (4)
- NOX5 (4)
- ASIC4 (3)
- BEST1 (3)
- BEST4 (3)
- CACNA2D1 (3)
- CACNA2D2 (3)
- CACNA2D4 (3)
- CACNB3 (3)
- CACNG4 (3)
- CACNG6 (3)
- CATSPER2 (3)
- CLCN2 (3)
- CLCN4 (3)
- CLCN5 (3)
- CLIC5 (3)
- GJC2 (3)
- GJD2 (3)
- KCNE3 (3)
- KCNH7 (3)
- KCNMB1 (3)
- KCNMB4 (3)
- KCTD11 (3)
- KCTD6 (3)
- VDAC3 (3)
- CATSPER1 (2)
- CATSPER3 (2)
- CLCA4 (2)
- CLCN1 (2)
- CLCN3 (2)
- CLCN6 (2)
- CLIC2 (2)
- FXYD1 (2)
- FXYD7 (2)
- GJA3 (2)
- GJA8 (2)
- GJB4 (2)
- KCNIP1 (2)
- KCTD1 (2)
- KCTD10 (2)
- POLR2M (2)
- SCNN1B (2)
- SCNN1D (2)
- SCNN1G (2)
- SHKBP1 (2)
- TPCN2 (2)
- TTYH1 (2)
- ZACN (2)
- ASIC3 (1)
- ASIC5 (1)
- CACNA2D3 (1)
- CACNG3 (1)
- CACNG7 (1)
- CATSPER4 (1)
- CLCA2 (1)
- CLCN7 (1)
- GJB5 (1)
- KCNAB3 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Assay Platforms
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (80)
- Cardiac muscle contraction (60)
- Dilated cardiomyopathy (60)
- Hypertrophic cardiomyopathy (HCM) (60)
- MAPK signaling pathway (60)
- Amyotrophic lateral sclerosis (ALS) (24)
- Gap junction (23)
- Purine metabolism (19)
- Calcium signaling pathway (16)
- Huntington's disease (16)
- Parkinson's disease (16)
- Vascular smooth muscle contraction (16)
- Taste transduction (13)
- Leukocyte transendothelial migration (12)
- Olfactory transduction (12)
- ABC transporters (4)