Primary Antibodies

View as table Download

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

Rabbit Polyclonal Anti-CYP1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cyp1b1 antibody is: synthetic peptide directed towards the middle region of human CYP1B1

Rabbit anti-TBXAS1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TBXAS1

Rabbit Polyclonal Anti-CYP4B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4B1 antibody: synthetic peptide directed towards the N terminal of human CYP4B1. Synthetic peptide located within the following region: SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW

Rabbit polyclonal Cytochrome P450 19A1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1.

Rabbit polyclonal CYP27B1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1.

Rabbit anti-CYP2E1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP2E1

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV

Rabbit Polyclonal Anti-CYP2D6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the N terminal of human CYP2D6. Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE

Rabbit Polyclonal Anti-CYP4F3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF

Rabbit Polyclonal Anti-CYP4A22 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ

Rabbit Polyclonal Anti-CYP26B1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the N terminal of human CYP26B1. Synthetic peptide located within the following region: LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV

Rabbit Polyclonal Anti-CYP2E1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV

Rabbit Polyclonal Anti-Cytochrome P450 26A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 26A1 Antibody: A synthesized peptide derived from human Cytochrome P450 26A1

Rabbit polyclonal Cytochrome P450 2R1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2R1.

Rabbit polyclonal CYP1A2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2.

Rabbit anti-CYP1A1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP1A1

Rabbit Polyclonal Anti-Cytochrome P450 2U1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2U1 Antibody: A synthesized peptide derived from human Cytochrome P450 2U1

Rabbit Polyclonal Antibody against Cyp-46

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to residues between 200-250 of human Cyp46.

Goat Polyclonal Antibody against P4HA1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DFARKDEPDAFKE, from the internal region of the protein sequence according to NP_000908.2; NP_001017962.1.

Rabbit polyclonal Cytochrome P450 2E1 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 2E1.
Modifications Phospho-specific

Rabbit polyclonal Cytochrome P450 2D6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2D6.

Rabbit polyclonal anti-PTGIS antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PTGIS.

Rabbit polyclonal Cytochrome P450 39A1 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 39A1.

Rabbit polyclonal Cytochrome P450 4Z1 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 4Z1.

Rabbit polyclonal CYP2B6 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6.

Rabbit polyclonal CYP2S1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP2S1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 399-428 amino acids from the C-terminal region of human CYP2S1.

Rabbit polyclonal CYP17A1 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP17A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-388 amino acids from the Central region of human CYP17A1.

Rabbit anti-CYP19A1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP19A1

Rabbit anti-CYP2A6 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP2A6

Rabbit Polyclonal Anti-CYP20A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP20A1 antibody: synthetic peptide directed towards the N terminal of human CYP20A1. Synthetic peptide located within the following region: ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV

Rabbit Polyclonal Anti-CYP26B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the middle region of human CYP26B1. Synthetic peptide located within the following region: SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

Rabbit Polyclonal Anti-CYP2D6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the middle region of human CYP2D6. Synthetic peptide located within the following region: EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV

Rabbit Polyclonal Anti-CYP2A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the N terminal of human CYP2A7. Synthetic peptide located within the following region: MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN

Rabbit Polyclonal Anti-CYP3A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI

Rabbit Polyclonal Anti-CYP3A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG

Rabbit Polyclonal Anti-CYP2A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP2A7 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2A7. Synthetic peptide located within the following region: EGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVFATIPRNYTMSF

Rabbit Polyclonal Anti-CYP2B6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL

Rabbit Polyclonal Anti-CYP2C18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C18 antibody: synthetic peptide directed towards the N terminal of human CYP2C18. Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM

Rabbit Polyclonal Anti-CYP4A22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS

Rabbit Polyclonal Anti-Cytochrome P450 2B6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2B6 Antibody: A synthesized peptide derived from human Cytochrome P450 2B6

Rabbit Polyclonal Anti-Cytochrome P450 2J2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2J2 Antibody: A synthesized peptide derived from human Cytochrome P450 2J2

Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2

Goat Polyclonal Anti-CYP26A1 Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP26A1 Antibody: Peptide with sequence C-NLPARFTHFHGE, from the internal region of the protein sequence according to NP_000774.2; NP_476498.1.

Rabbit Polyclonal CYP1B1 Antibody

Applications ELISA, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Antibody against Aromatase

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human aromatase protein sequence (between residues 400-502).

Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928)

Rabbit polyclonal Cytochrome P450 26A1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 26A1.