Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
CYP27A1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1. |
CYP39A1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide from Human Cytochrome P450 39A1. |
Rabbit Polyclonal Antibody against Cyp-46
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to residues between 200-250 of human Cyp46. |
Rabbit polyclonal Cytochrome P450 39A1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 39A1. |
Rabbit polyclonal Cytochrome P450 7B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1. |
Rabbit polyclonal Cytochrome P450 27A1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 27A1. |
Rabbit polyclonal anti-CYP39A1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP39A1. |
Rabbit polyclonal CYP8B1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Mouse monoclonal Anti-Cytochrome P450 39A1 Clone M30P6D6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP7B1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
CYP7B1 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Human |
Immunogen | Peptide with sequence C-YPDSDVLFRYKVKS, from the C Terminus of the protein sequence according to NP_004811.1. |
Rabbit Polyclonal Anti-CYP46A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CYP46A1 Antibody: synthetic peptide directed towards the C terminal of human CYP46A1. Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM |
Rabbit Polyclonal Anti-CYP7B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE |
Mouse monoclonal Anti-Cytochrome P450 7B1 Clone M17-P3F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Cytochrome P450 8B1 Clone M15-P3B7
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
CYP7B1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP7B1 |
Rabbit Polyclonal Anti-CYP27A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP27A1 antibody: synthetic peptide directed towards the middle region of human CYP27A1 |
Rabbit Polyclonal Anti-CYP8B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP8B1 antibody: synthetic peptide directed towards the middle region of human CYP8B1. Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP |
Carrier-free (BSA/glycerol-free) Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYP7B1 mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CYP27A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP27A1 |
Rabbit Polyclonal Anti-CYP39A1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP39A1 |
Rabbit Polyclonal Anti-CYP46A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP46A1 |
Rabbit Polyclonal Anti-CYP7A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP7A1 |
Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYP7B1 mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CYP7B1 mouse monoclonal antibody,clone OTI1G7, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CYP7B1 mouse monoclonal antibody,clone OTI1G7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CYP7B1 mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |