Primary Antibodies

View as table Download

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

CYP27A1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1.

CYP39A1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide from Human Cytochrome P450 39A1.

Rabbit Polyclonal Antibody against Cyp-46

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to residues between 200-250 of human Cyp46.

Rabbit polyclonal Cytochrome P450 39A1 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 39A1.

Rabbit polyclonal Cytochrome P450 7B1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1.

Rabbit polyclonal Cytochrome P450 27A1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 27A1.

Rabbit polyclonal anti-CYP39A1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CYP39A1.

Rabbit polyclonal CYP8B1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1.

Mouse monoclonal Anti-Cytochrome P450 39A1 Clone M30P6D6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP7B1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

CYP7B1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Human
Immunogen Peptide with sequence C-YPDSDVLFRYKVKS, from the C Terminus of the protein sequence according to NP_004811.1.

Rabbit Polyclonal Anti-CYP46A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP46A1 Antibody: synthetic peptide directed towards the C terminal of human CYP46A1. Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM

Rabbit Polyclonal Anti-CYP7B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE

Mouse monoclonal Anti-Cytochrome P450 7B1 Clone M17-P3F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse monoclonal Anti-Cytochrome P450 8B1 Clone M15-P3B7

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

CYP7B1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CYP7B1

Rabbit Polyclonal Anti-CYP27A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP27A1 antibody: synthetic peptide directed towards the middle region of human CYP27A1

Rabbit Polyclonal Anti-CYP8B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP8B1 antibody: synthetic peptide directed towards the middle region of human CYP8B1. Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP

Carrier-free (BSA/glycerol-free) Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYP7B1 mouse monoclonal antibody,clone OTI1G7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CYP27A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CYP27A1

Rabbit Polyclonal Anti-CYP39A1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP39A1

Rabbit Polyclonal Anti-CYP46A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP46A1

Rabbit Polyclonal Anti-CYP7A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP7A1

Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-Cyp7b1 mouse monoclonal antibody, clone OTI7H10 (formerly 7H10)

Applications WB
Reactivities Human
Conjugation Unconjugated

CYP7B1 mouse monoclonal antibody,clone OTI1G7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP7B1 mouse monoclonal antibody,clone OTI1G7, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

CYP7B1 mouse monoclonal antibody,clone OTI1G7, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

CYP7B1 mouse monoclonal antibody,clone OTI1G7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated