Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Mouse Monoclonal TFRC (CD71) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-TFRC Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFRC |
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANPEP |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit anti-MME Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MME |
Rabbit polyclonal CD71 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD71 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 649-677 amino acids from the C-terminal region of human CD71. |
CD10 (MME) mouse monoclonal antibody, clone B-E3, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
CD71 (TFRC) mouse monoclonal antibody, clone B-G24, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
Rabbit polyclonal MME Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME. |
CD71 (TFRC) mouse monoclonal antibody, clone SOM4D10, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD10 (MME) mouse monoclonal antibody, clone B-E3, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD71 (TFRC) (169-377) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 169 and 377 of CD71. Amino acid sequence homology: Cat (86%), Dogs (81%), Pig (82%). |
CD71 (TFRC) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of Human CD71 |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Biotin
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | Biotin |
Rabbit polyclonal MME Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 721-747 amino acids from the C-terminal region of human MME. |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
CD71 (TFRC) mouse monoclonal antibody, clone CY-TFR, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD10 (MME) mouse monoclonal antibody, clone B-E3, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified
| Applications | FC |
| Reactivities | Human |
CD71 (TFRC) mouse monoclonal antibody, clone B-G24, Azide Free
| Applications | FC |
| Reactivities | Human |
CD71 (TFRC) mouse monoclonal antibody, clone B-G24, Purified
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | APC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | PE |
CD71 (TFRC) mouse monoclonal antibody, clone DF1513, Low Endotoxin
| Applications | FC |
| Reactivities | Human, Monkey |
Mouse Anti-Human CD13 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD10 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Mouse monoclonal Anti-CALLA Clone SS2/36
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Transferrin receptor Clone Q1/71
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti CD10 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to internal region of human CD10 |
Carrier-free (BSA/glycerol-free) MME mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-MME Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 519-533 amino acids of human membrane metallo-endopeptidase |
Active filters
Families
- Protease
Pathways
- Hematopoietic cell lineage