Primary Antibodies

View as table Download

Rabbit anti-B2M Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human B2M

Mouse Monoclonal Calreticulin Antibody (1G6A7)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit anti-CALR Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CALR

Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Antibody against CD8A (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A.

Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Rat
Immunogen This CALR Antibody is generated from rabbits immunized with a recombinant protein of human CALR.

CD8A mouse monoclonal antibody, clone CT6, Supernatant

Applications FC, IHC
Reactivities Guinea Pig

Rabbit polyclonal anti-CALR antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CALR.

Rabbit Polyclonal Anti-CALR Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CALR antibody: synthetic peptide directed towards the middle region of human CALR. Synthetic peptide located within the following region: ASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWE

Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Rat
Immunogen This CALR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the Central region of Human CALR.

beta 2 Microglobulin (B2M) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Human b2-Microglobulin.

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH

B2M / Beta 2 Microglobulin Mouse Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal B2M Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen B2M antibody was raised against a 15 amino acid peptide near the carboxy terminus of human B2M.

Rabbit Polyclonal Anti-CALR Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALR antibody: synthetic peptide directed towards the middle region of human CALR. Synthetic peptide located within the following region: PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT

Rabbit Polyclonal Anti-CALR Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CALR antibody is: synthetic peptide directed towards the N-terminal region of Human CALR. Synthetic peptide located within the following region: SSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQ

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR

Rabbit Polyclonal Anti-CD8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B

LTA (Center) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 46-72 amino acids from the Central region of Human LTA.

LTA rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CD8A mouse monoclonal antibody, clone LT8, Azide Free

Applications FC, IHC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone LT8, Purified

Applications FC, IHC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone LT8, Purified

Applications FC, IHC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone LT8, Purified

Applications FC, IHC, IP
Reactivities Human, Monkey

Rabbit Polyclonal Antibody against CD8A (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A.

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7

Applications FC, IHC
Reactivities Human
Conjugation APC-Cy7

CD8A mouse monoclonal antibody, clone RFT-8, Cy5

Applications FC, IHC
Reactivities Human
Conjugation Cy5

CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin

Applications FC, IHC
Reactivities Human

CD8A mouse monoclonal antibody, clone RFT-8, Purified

Applications FC, IHC
Reactivities Human

CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5

Applications FC, IHC
Reactivities Human
Conjugation PE-Cy5.5

CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7

Applications FC, IHC
Reactivities Human
Conjugation PE-Cy7

beta 2 Microglobulin (B2M) mouse monoclonal antibody, clone D6D1, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified

Applications IHC, IP
Reactivities Human, Rat

CD8A mouse monoclonal antibody, clone B-Z31, Azide Free

Applications FC, IHC
Reactivities Human

CD8A mouse monoclonal antibody, clone B-Z31, Purified

Applications FC, IHC
Reactivities Human

CD8A mouse monoclonal antibody, clone MCD8, Aff - Purified

Applications FC, IHC
Reactivities Human

CD8A mouse monoclonal antibody, clone MEM-87, Purified

Applications FC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone MEM-31, Purified

Applications FC, IP
Reactivities Human

Rabbit Polyclonal antibody to interferon alpha 8 (interferon, alpha 8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 189 of interferon alpha 8 (Uniprot ID#P32881)

Rabbit polyclonal Beta-2-Microglobulin antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Beta-2-Microglobulin Antibody was produced by repeated immunizations with human beta-2-Microglobulin protein isolated from urine.

Mouse Monoclonal CD8 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal anti-CALR antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALR antibody: synthetic peptide directed towards the C terminal of human CALR. Synthetic peptide located within the following region: KEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL