Primary Antibodies

View as table Download

IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700023

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]

Rabbit Polyclonal IFN-beta Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta.

Mouse Anti-Human IL-1 beta Purified (50 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.

IP10 (CXCL10) mouse monoclonal antibody, Azide Free

Applications ELISA, WB
Reactivities Human

IL6 mouse monoclonal antibody, clone B-E8, Azide Free

Applications ELISA, FC, FN
Reactivities Human

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta

Mouse IL-33 Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Goat Anti-IL18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1.

Interferon beta (IFNB1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly purified (>98%) E.coli derived recombinant Human Inferferon beta.

Anti-Human IP-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IP-10 (CXCL10)

IL6 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6

IL6 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6

Rabbit Polyclonal IL-33 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-33 antibody was raised against a 19 amino acid peptide from near the center of human IL-33.

CCL5 / RANTES Mouse Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit anti-IFNB1 Polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human IFNB1

Rabbit anti-CCL5 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CCL5

Rabbit Polyclonal Anti-Interleukin 1β Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β

IL6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 26-55 amino acids from the Central region of Human Interleukin-6

Interferon beta (IFNB1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly purified (>98%) E.coli derived recombinant Human Inferferon beta.

IL1 beta (IL1B) rabbit polyclonal antibody, Azide Free

Applications ELISA, FN, WB
Reactivities Chicken
Immunogen Recombinaint Chicken IL-1B

Mouse IL-33 Monoclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse

Rabbit anti-IL1B Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IL1B

Anti-Human IL-6 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-6

IP10 (CXCL10) mouse monoclonal antibody, clone B-C50, Azide Free

Applications FC
Reactivities Human

IP10 (CXCL10) mouse monoclonal antibody, clone B-C55, Azide Free

Reactivities Human

IL6 goat polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98%) recombinant human IL-6

IL6 rabbit polyclonal antibody, Azide Free

Applications ELISA, FN, WB
Reactivities Chicken
Immunogen Recombinant Chicken IL-6.

Rabbit Polyclonal IL-33 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-33 antibody was raised against a 19 amino acid peptide from near the amino terminus of human IL-33.

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

Rabbit Polyclonal CCL4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4.

Biotinylated Anti-Human IFN-β Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human IFN-β

Anti-Human IFN-β Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human IFN-β

Anti-Human RANTES Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human RANTES (CCL5)

Rabbit Polyclonal Interferon beta Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.

Rabbit Polyclonal CXCL10/INP10 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.

IP10 (CXCL10) mouse monoclonal antibody, clone B-C50, FITC

Applications FC
Reactivities Human
Conjugation FITC

IL1 beta (IL1B) mouse monoclonal antibody, clone B-A15, Azide Free

Applications FC, FN
Reactivities Human

IL6 mouse monoclonal antibody, clone B-F6, Azide Free

Applications IP, WB
Reactivities Human

IL6 mouse monoclonal antibody, clone AT1F10, Purified

Applications ELISA, WB
Reactivities Human

IL6 mouse monoclonal antibody, clone AT1F10, Purified

Applications ELISA, WB
Reactivities Human

Interferon beta (IFNB1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen A 17 amino acid peptide located near the centre of human Interferon beta.

IL6 goat polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98%) recombinant human IL-6

Interferon beta (IFNB1) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98%) E.coli derived recombinant Human IFN beta

Rabbit Polyclonal antibody to interferon alpha 8 (interferon, alpha 8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 189 of interferon alpha 8 (Uniprot ID#P32881)

Rabbit polyclonal anti-IL-18 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 41 of human IL-18

Anti-Human IL-6 Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-6

Rabbit Polyclonal Anti-IL33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC