Germany
Japan
United Kingdom
China
USD 420.00
In Stock
Primary Antibodies
View as table Download
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
Rabbit anti-LIPC Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIPC |
Rabbit Polyclonal Anti-PON3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PON3 antibody: synthetic peptide directed towards the middle region of human PON3. Synthetic peptide located within the following region: PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY |
CD75 (ST6GAL1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human CD75. |
Rabbit anti-HPSE Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HPSE |
Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201) |
Rabbit Polyclonal antibody to ABO (ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase))
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 95 and 299 of ABO |
Rabbit polyclonal PLA2G7 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLA2G7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the Central region of human PLA2G7. |
ABO Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABO |
Rabbit Polyclonal Anti-PLA2G5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC |
DBH Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBH |
Rabbit Polyclonal Anti-PLA2G5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW |
Rabbit Polyclonal Anti-PON3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PON3 antibody: synthetic peptide directed towards the middle region of human PON3. Synthetic peptide located within the following region: FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF |
Rabbit Polyclonal Anti-LIPF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF. Synthetic peptide located within the following region: ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH |
Rabbit Polyclonal antibody to GALNT2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 55 and 369 of GALNT2 (Uniprot ID#Q10471) |
Rabbit polyclonal anti-DBH antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DBH. |
Anti-FLOT2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.420~424(I-K-K-A-T) derived from Human ESA (FLOT2). |
Anti-HPSE Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 250 amino acids of human heparanase |
Rabbit Polyclonal Anti-PNLIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ |
Rabbit Polyclonal Anti-ST3GAL4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST3GAL4 antibody: synthetic peptide directed towards the middle region of human ST3GAL4. Synthetic peptide located within the following region: FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV |
Rabbit Polyclonal Anti-HYAL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: TIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPD |
CD75 (ST6GAL1) mouse monoclonal antibody, clone B-L5, Azide Free
| Applications | FC |
| Reactivities | Human |
Rabbit polyclonal antibody to alpha 2A amylase(pancreatic) (amylase, alpha 2A (pancreatic))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 156 and 430 of alpha amylase 2A (pancreatic) (Uniprot ID#P04746) |
Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1) |
Sheep Anti-Dopamine β-Hydroxylase, C-Terminus, Human Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Anti-HPSE Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 250 amino acids of human heparanase |
Rabbit Polyclonal Anti-PNLIP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV |
Rabbit Polyclonal Anti-HYAL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY |
CD75 (ST6GAL1) mouse monoclonal antibody, clone B-L5, Purified
| Applications | FC |
| Reactivities | Human |
Active filters
Families
- Secreted Protein
Pathways
- Metabolic pathways
Filter by
Category
Target Symbol
- LIPG (133)
- PON3 (33)
- PON1 (32)
- PLA2G3 (19)
- CNDP1 (18)
- PNLIP (15)
- AMY2A (12)
- AMY2B (8)
- ST6GAL1 (8)
- DBH (7)
- LIPC (6)
- HPSE (5)
- ABO (3)
- PLA2G5 (3)
- AMY1A (2)
- GALNT2 (2)
- HYAL1 (2)
- HYAL3 (2)
- PLA2G12A (2)
- ST3GAL1 (2)
- ST3GAL3 (2)
- ST3GAL4 (2)
- LIPF (1)
- PLA2G12B (1)
- PLA2G1B (1)
- PLA2G2D (1)
- PLA2G2E (1)
- PLA2G7 (1)