Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-IFNG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IFNG

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin

Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified

Applications ELISA, IHC
Reactivities Bovine, Human, Mouse, Porcine, Rat

Rabbit Polyclonal Anti-Interferon gamma Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma
INS

USD 320.00

In Stock

Goat Polyclonal Anti-INS Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human Insulin produced in E. coli as a fusion protein.

Interferon gamma (IFNG) mouse monoclonal antibody, clone 315, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Interferon gamma (IFNG) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 31-80 of Human IFN-γ.

Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 5E4/3 (D6C4), Purified

Applications ELISA, IHC
Reactivities Bovine, Human, Mouse, Porcine, Rat

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

Anti-Human IFN-? Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IFN-γ

Rabbit anti-IFNG Polyclonal Antibody

Applications IHC, WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IFNG

Insulin (INS) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Bovine, Porcine, Rat
Conjugation Unconjugated

Interferon gamma (IFNG) mouse monoclonal antibody, clone GC8

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Interferon gamma (IFNG) mouse monoclonal antibody, clone GF1

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Interferon gamma (IFNG) mouse monoclonal antibody, clone G-23, Aff - Purified

Applications FC, WB
Reactivities Human

Interferon gamma (IFNG) mouse monoclonal antibody, clone 165, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Interferon gamma (IFNG) mouse monoclonal antibody, clone 3F1E3, Aff - Purified

Applications ELISA, WB
Reactivities Human

Interferon gamma (IFNG) mouse monoclonal antibody, clone 45-14, APC

Applications FC, IF
Reactivities Human
Conjugation APC

Interferon gamma (IFNG) mouse monoclonal antibody, clone 45-14, FITC

Applications FC, IF
Reactivities Human
Conjugation FITC

Interferon gamma (IFNG) mouse monoclonal antibody, clone 45-14, Aff - Purified

Applications FC, IF
Reactivities Human

Interferon gamma (IFNG) mouse monoclonal antibody, clone 45-14, PE

Applications FC, IF
Reactivities Human
Conjugation PE

Insulin (INS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Insulin (INS) (+Proinsulin) guinea pig polyclonal antibody, Serum

Applications IF, IHC
Reactivities Hamster, Human, Porcine, Rat
Immunogen Synthetic Human proinsulin

Interferon gamma (IFNG) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly purified recombinant Inferferon gamma.

Rabbit Polyclonal antibody to interferon alpha 8 (interferon, alpha 8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 189 of interferon alpha 8 (Uniprot ID#P32881)

Mouse Monoclonal Anti-IFN-gamma Antibody

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 3A6

Applications ELISA
Reactivities Bovine, Human, Porcine
Conjugation Unconjugated

Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 7F8

Applications ELISA
Conjugation Unconjugated

Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 8E2

Applications ELISA
Reactivities Bovine, Human, Porcine
Conjugation Unconjugated

Insulin (INS) (beta chain) mouse monoclonal antibody, clone C7C9

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Interferon gamma (IFNG) mouse monoclonal antibody, clone 23, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Insulin (INS) mouse monoclonal antibody, clone ISL-8J, Purified

Applications IHC
Reactivities Human, Mouse, Rat

Interferon gamma (IFNG) mouse monoclonal antibody, clone B-B1, FITC

Applications FC
Conjugation FITC

Insulin (INS) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen C-Peptide conjugate EAEDLQVGQVKKKC- KLH

Insulin (INS) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen C-Peptide conjugate EAEDLQVGQVKKKC- KLH

Rabbit polyclonal antibody to Interferon alpha-6 (interferon, alpha 6)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 189 of interferon alpha 6 (Uniprot ID#P05013)

Rabbit polyclonal IFNA4 Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4.

Biotinylated Anti-Human IFN-? Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IFN-γ

Rabbit Polyclonal Anti-IFNA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IFNA7 Antibody: synthetic peptide directed towards the N terminal of human IFNA7. Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

Rabbit Polyclonal Anti-IFNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5. Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

Rabbit Polyclonal Anti-IFNA13 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-IFNA13 antibody: synthetic peptide directed towards the C terminal of human IFNA13. Synthetic peptide located within the following region: ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Rabbit Polyclonal Anti-IFNA16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNA16 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA16. Synthetic peptide located within the following region: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD

Rabbit Polyclonal Anti-IFNA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Mouse Monoclonal Anti-IFN-gamma Antibody, Biotin conjugated

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Mouse Monoclonal Anti-IFN-gamma Antibody, FITC conjugated

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated