IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700022 |
IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700022 |
lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700017 |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit Polyclonal Anti-IFNG Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IFNG |
TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700026 |
CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700027 |
USD 379.00
In Stock
lFN-g Capture mouse monoclonal antibody, ELISA and Luminex validated, clone B140
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700016 |
IL10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10. |
ICOS Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ICOS |
IL5 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5 |
Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD8A (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Mouse Monoclonal Anti-IL-2 Antibody [Clone ID: B-G5]
Reactivities | Human |
Conjugation | Unconjugated |
GM CSF (CSF2) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 59-85 amino acids from the Central region of Human CSF2 |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
Applications | FC, IHC |
Reactivities | Guinea Pig |
Rabbit polyclonal anti-IL-2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-2 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein. |
IL2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL2 |
IL10 mouse monoclonal antibody, clone B-S10, Azide Free
Applications | ELISA, FN |
Reactivities | Human |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
Rabbit polyclonal anti-GM-CSF antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human GM-CSF protein. |
Anti-Human IL-5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-5 |
Rabbit Polyclonal Anti-Interleukin 2 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 2 Antibody: A synthesized peptide derived from human Interleukin 2 |
Rabbit Polyclonal Anti-Interleukin 4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4 |
Goat Polyclonal Anti-IL10 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human IL10 produced in E. coli. |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Azide Free
Applications | FC, IHC |
Reactivities | Human |
TNF alpha (TNF) (1-234) mouse monoclonal antibody, clone M1-C4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Rat |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
Rabbit polyclonal anti-GM-CSF antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed human GM-CSF |
Anti-Human IL-4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-4 |
Anti-Human IL-10 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-10 |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR |
Rabbit Polyclonal Anti-Interleukin 5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5 |
Rabbit Polyclonal Anti-CD8A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B |
Rabbit Polyclonal Anti-Interferon gamma Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
Applications | E |
Reactivities | Human, Monkey |
Conjugation | Biotin |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 315, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
IL2 mouse monoclonal antibody, clone B-G5, Azide Free
Applications | FC, FN, WB |
Reactivities | Human |
IL10 mouse monoclonal antibody, clone BN-10, FITC
Applications | FC, IHC |
Reactivities | Human |
Conjugation | FITC |
Interferon gamma (IFNG) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 31-80 of Human IFN-γ. |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human |