Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit Polyclonal PAPOLA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPOLA antibody: human PAPOLA (polyA polymerase alpha), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Non Neuronal Enolase (ENO1) (178-205) rabbit polyclonal antibody, Ig Fraction
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal Anti-CNOT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT7 antibody: synthetic peptide directed towards the N terminal of human CNOT7. Synthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP |
USD 475.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT3 antibody: synthetic peptide directed towards the C terminal region of human CNOT3. Synthetic peptide located within the following region: MMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDL |
USD 385.00
2 Weeks
Non Neuronal Enolase (ENO1) mouse monoclonal antibody, clone NSE-P1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal CAF-1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1. |
Rabbit polyclonal CNOT8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CNOT8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from the C-terminal region of human CNOT8. |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal Anti-CNOT6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT6 antibody: synthetic peptide directed towards the N terminal of human CNOT6. Synthetic peptide located within the following region: EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN |
Rabbit Polyclonal Anti-PAPOLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPOLG antibody: synthetic peptide directed towards the middle region of human PAPOLG. Synthetic peptide located within the following region: SVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLT |
Rabbit Polyclonal Anti-DCP1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI |
Rabbit Polyclonal Anti-DCP1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP1A Antibody: A synthesized peptide derived from human DCP1A |
Rabbit polyclonal CNOT2 (Ab-101) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CNOT7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CNOT7. |
USD 450.00
5 Days
Mouse monoclonal ENO1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal DCP1A antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DCP1A. |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
USD 450.00
2 Weeks
CCR4 NOT transcription complex subunit 3 (CNOT3) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 142-171 amino acids from the N-terminal region of human CNOT3 |
Rabbit Polyclonal Anti-CNOT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG |
CNOT8 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 32-60 amino acids from the N-terminal region of human CNOT8 |
Rabbit Polyclonal Antibody against CNOT4 (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CNOT4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-84 amino acids from the N-terminal region of human CNOT4. |
Goat Polyclonal Antibody against DCP1A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QVLTKNKDNHN, from the C Terminus of the protein sequence according to NP_060873.3. |
Rabbit Polyclonal CNOT4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CNOT4 antibody was raised against a 19 amino acid peptide near the amino terminus of the human CNOT4. |
Rabbit anti-Dcp1a polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal Anti-CNOT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT7 antibody: synthetic peptide directed towards the middle region of human CNOT7. Synthetic peptide located within the following region: LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG |
Rabbit Polyclonal Anti-CNOT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR |
USD 375.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT3 Antibody: synthetic peptide directed towards the N terminal of human CNOT3. Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML |
USD 310.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT3 Antibody: synthetic peptide directed towards the N terminal of human CNOT3. Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML |
Rabbit Polyclonal Anti-DCP1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: EEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGD |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI4C7 (formerly 4C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI3B8 (formerly 3B8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Families
- Transcription Factors
Pathways
- RNA degradation