CD86 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD86 |
CD86 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD86 |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
Rabbit Polyclonal Anti-EIF4G2 Antibody
Applications | WB |
Reactivities | Chicken, Human, Turkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the C terminal of human EIF4G2. Synthetic peptide located within the following region: KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV |
Rabbit Polyclonal Anti-ABL1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ABL1 |
Rabbit Polyclonal Anti-EIF4G2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the N terminal of human EIF4G2. Synthetic peptide located within the following region: PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLL |
Rabbit Polyclonal Anti-EIF4G3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF4G3 antibody: synthetic peptide directed towards the N terminal of human EIF4G3. Synthetic peptide located within the following region: TAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIA |
Rabbit Polyclonal Anti-EIF4G3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF4G3 antibody: synthetic peptide directed towards the middle region of human EIF4G3. Synthetic peptide located within the following region: MRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRES |
Mouse Monoclonal Anti-CD80 Antibody [11C12]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD80 Antibody [12D9]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
DAP5 (EIF4G2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
c Abl (ABL1) pTyr393/439 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic phosphopeptide derived from human ABL1/2 around the phosphorylation site of Tyrosine 393/439. |
Rabbit Polyclonal antibody to DAP5 (eukaryotic translation initiation factor 4 gamma, 2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 194 of DAP5 |
Rabbit polyclonal anti-ABL1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABL1. |
Rabbit polyclonal ABL1 (Thr735) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ABL1 around the phosphorylation site of threonine 735 (S-V-TP-L-P). |
Modifications | Phospho-specific |
Anti-ABL1/ABL2 (phospho-Tyr393/429) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 393/429 (D-T-Y(p)-T-A) derived from Human ABL1/2. |
Modifications | Phospho-specific |
Rabbit Polyclonal c-Abl Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Abl |
Rabbit Polyclonal Abl (Tyr204) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 204 |
Modifications | Phospho-specific |
Rabbit Polyclonal Abl (Tyr393/412) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 393/412 |
Modifications | Phospho-specific |
Rabbit Polyclonal Abl (Tyr412) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 412 |
Modifications | Phospho-specific |
Rabbit Polyclonal c-Abl (Tyr245) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Abl around the phosphorylation site of Tyrosine 245 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CD80 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80. |
Rabbit Polyclonal Anti-CD86 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86. |
Mouse Monoclonal Anti-CD80 Antibody [8G12]
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD80 Antibody [10A1]
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD80 Antibody [11D1]
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, Azide Free
Applications | FC, FN |
Reactivities | Human |
SMURF 2 (SMURF2) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human SMURF2. |
c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
c Abl (ABL1) pTyr412 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
DAP5 (EIF4G2) (1-204) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 204 of Human DAP5 |
Rabbit Polyclonal Abl Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Abl |
Rabbit Polyclonal c-Abl Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of human c Abl (within residues 700-800). [Swiss-Prot# P00519] |
Mouse Monoclonal DAP5 Antibody (39C534.1)
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse anti c-Abl Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD80 Antibody [7A2]
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
purified CD80 Capture mouse monoclonal antibody, Luminex validated, clone OTI2E5
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700489 |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, Purified
Applications | FC |
Reactivities | Human |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
c Abl (ABL1) pTyr204 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal anti-EIF4G2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EIF4G2. |
Hamster Anti-Mouse CD80 (B7-1) Purified (50 ug)
Applications | FC |
Reactivities | Canine, Mouse, Pig |
Conjugation | Unconjugated |
Mouse Anti-Human CD80 (B7-1) Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal c-Abl Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Abl |
Mouse monoclonal Anti-CD86 Clone BU63
Reactivities | Human |
Conjugation | Unconjugated |
purified CD80 Capture mouse monoclonal antibody, Luminex validated, clone OTI2B11
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700490 |