Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Polyclonal Trk B (Tyr515) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk B around the phosphorylation site of Tyrosine 515 (peptide seq 509-521aa: VIENPQY(p)FGITN) |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against NGFR
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AKREEVEKLLNG, from the internal region of the protein sequence according to NP_002498.1. |
p75 NGF Receptor (NGFR) mouse monoclonal antibody, clone ME20.4, Biotin
| Applications | FC, IF, IHC, IP, NEUT, WB |
| Reactivities | Human |
| Conjugation | Biotin |
p75 NGF Receptor (NGFR) mouse monoclonal antibody, clone ME20.4, FITC
| Applications | FC, IF, IHC, IP, NEUT, WB |
| Reactivities | Human |
| Conjugation | FITC |
p75 NGF Receptor (NGFR) mouse monoclonal antibody, clone ME20.4, Purified
| Applications | FC, IF, IHC, IP, NEUT, WB |
| Reactivities | Human |
Rabbit anti-NTRK3 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NTRK3 |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF antibody is: synthetic peptide directed towards the N-terminal region of Human BDNF. Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL |
BCL2 (41-54) mouse monoclonal antibody, clone Bcl2/100, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
Goat Polyclonal Antibody against BCL2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AGRTGYDNREIVMKYC, from the N Terminus of the protein sequence according to NP_000624; NP_000648. |
Rabbit polyclonal Trk B (Ab-515) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Trk B around the phosphorylation site of tyrosine 515 (P-Q-YP-F-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Trk B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk B |
Rabbit Polyclonal Anti-FASL Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL |
Rabbit polyclonal Trk A (Phospho-Tyr791) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 791 (P-V-YP-L-D) |
| Modifications | Phospho-specific |
Rabbit polyclonal Trk A (Phospho-Tyr701) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 701 (I-L-YP-R-K). |
| Modifications | Phospho-specific |
NGFR Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NGFR |
Mouse Monoclonal anti-Bax Antibody
| Applications | IP |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Human p75NTR(extracellular)
| Applications | FC, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CEEIPGRWITRSTPPE, corresponding to amino acid residues 188-203 of human p75NTR. Extracellular, stalk domain. |
Rabbit Polyclonal Anti-Neurotensin Receptor 2
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CGEQHSLVPLPQEAPE, corresponding to amino acidresidues 377-392 of rat Neurotensin Receptor 2. Intracellular, C-terminus. |
Mouse Monoclonal p75NTR/NGF Receptor Antibody (2F1C2)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TA336800 is a replacement of AM06398SU-N.
Rabbit Polyclonal Anti-Bax Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax |
Rabbit Polyclonal Anti-Presenilin 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1 |
Rabbit Polyclonal Anti-CD271 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD271 Antibody: A synthesized peptide derived from human CD271 |
Rabbit Polyclonal Anti-BCL-2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL-2 Antibody: A synthesized peptide derived from human BCL-2 |
Rabbit Polyclonal Anti-FAS ligand Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAS ligand Antibody: A synthesized peptide derived from human FAS ligand |
Active filters
Families
- Transmembrane
Pathways
- Neurotrophin signaling pathway