Rabbit Polyclonal Anti-SLC6A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC6A3 Antibody: synthetic peptide directed towards the N terminal of human SLC6A3. Synthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH |
Rabbit Polyclonal Anti-VDAC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF |
Rabbit Polyclonal Anti-SLC18A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC18A1 antibody: synthetic peptide directed towards the middle region of human SLC18A1. Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE |
Rabbit polyclonal Anti-NDUFA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFA9 antibody: synthetic peptide directed towards the N terminal of human NDUFA9. Synthetic peptide located within the following region: QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY |
Rabbit polyclonal Anti-PPID Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPID antibody: synthetic peptide directed towards the N terminal of human PPID. Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM |
Caspase 3 (CASP3) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human Caspase-3 (P10) |
Goat Polyclonal Antibody against SDHB
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ATYKEKKASV, from the C Terminus of the protein sequence according to NP_002991.1. |
Goat Polyclonal Antibody against VDAC2 (C Terminus)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GHKVGLALELEA, from the C Terminus of the protein sequence according to NP_003366.2. |
Goat Polyclonal Antibody against UBE2L3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EFTKKYGEKRPVD, from the C Terminus of the protein sequence according to NP_003338. |
Goat Polyclonal Antibody against VDAC2 (Internal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DSAKSKLTRNN, from the internal region of the protein sequence according to NP_003366.2. |
Goat Polyclonal Antibody against COX4I1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QGLASKWDYEKNE, from the C Terminus of the protein sequence according to NP_001852.1. |
Goat Anti-NDUFS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DTRPTVRPRNDVAHK, from the internal region of the protein sequence according to NP_004542.1. |
Rabbit Polyclonal Caspase-9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Caspase-9 antibody was raised against a peptide corresponding to amino acids 41 to 56 of human caspase-9 . |
Rabbit polyclonal antibody to ATP synthase C1(mitochondrial) (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 82 of ATP5G1 (Uniprot ID#P05496) |
Rabbit Polyclonal antibody to UBE1 (ubiquitin-like modifier activating enzyme 1)
| Reactivities | Human, Mouse |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 753 and 1006 of UBE1 (Uniprot ID#P22314) |
Rabbit polyclonal anti-COX6A2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human COX6A2. |
Rabbit polyclonal anti-COX5B antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX5B. |
Rabbit polyclonal anti-NDUC2 antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUC2. |
Rabbit polyclonal anti-NDUFS6 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFS6. |
Rabbit polyclonal anti-NDUFV3 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFV3. |
Rabbit polyclonal anti-HtrA2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human HtrA2. |
Rabbit polyclonal anti-Cytochrome c antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Rat cytochrome c |
Rabbit polyclonal anti-UBE2J1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues near the amino terminus of the human Ube2j1 protein. |
Rabbit polyclonal Ubiquitin-Conjugating Enzyme E2 J2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of the human Ube2j2 protein. |
Rabbit Polyclonal Caspase-3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Caspase-3 antibody was raised against a 17 amino acid synthetic peptide near the center of human Caspase-3. |
Anti-SNCA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.123~127 (E-A-Y-E-M ) derived from Human a-Synuclein. |
Anti-UCHL1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 165 amino acids of human ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) |
Anti-TH (Phospho-Ser31) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine31(V-T-S(p)-P-R) derived from human Tyrosine Hydroxylase |
| Modifications | Phospho-specific |
Anti-TH(Phospho-Ser40) Rabbit Polyclonal Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 40 (R-Q-S(p)-L-I) derived from Human Tyrosine Hydroxylase (TH). |
| Modifications | Phospho-specific |
Rabbit polyclonal SDHA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SDHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 577-605 amino acids from the C-terminal region of human SDHA. |
Rabbit polyclonal NDUFB10 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NDUFB10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-70 amino acids from the Central region of human NDUFB10. |
Rabbit Polyclonal Alpha-synuclein Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Alpha-synuclein. |
ATP5F1C Goat Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLTFNRTRQAVITKE, from C terminus of the protein sequence according to NP_005165.1 and NP_001001973.1. |
MT-ATP6 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Test: Human. Expected from seq similarity: Human |
| Immunogen | Internal region (PTSKYLINNRLITTQ) |
ATP5F1 (aa142-153) Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Internal region (SIQHIQNAIDTE) |
Rabbit Polyclonal Anti-COX7A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the middle region of Human COX7A2. Synthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY |
Rabbit Polyclonal Anti-COX7A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the C-terminal region of Human COX7A2. Synthetic peptide located within the following region: LFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE |
Rabbit Polyclonal Anti-COX6B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COX6B1 antibody is: synthetic peptide directed towards the N-terminal region of Human COX6B1. Synthetic peptide located within the following region: TAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQS |
Phospho-SNCA-S129 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S129 of human SNCA |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NDUFB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFB4 Antibody is: synthetic peptide directed towards the C-terminal region of Human NDUFB4. Synthetic peptide located within the following region: ARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK |
Rabbit Polyclonal Anti-UQCRQ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UQCRQ antibody is: synthetic peptide directed towards the middle region of Human UQCRQ. Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK |
Rabbit Polyclonal Anti-SLC25A31 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A31 Antibody: synthetic peptide directed towards the N terminal of human SLC25A31. Synthetic peptide located within the following region: LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP |
Rabbit Polyclonal Anti-Atp5d Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atp5d antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVQLLAEEAVTLDMLDLGAARANLEKAQSELSGAADEAARAEIQIRIEAN |
Rabbit Polyclonal Anti-NDUFC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFC1 antibody: synthetic peptide directed towards the middle region of human NDUFC1. Synthetic peptide located within the following region: RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL |
Rabbit Polyclonal Anti-NDUFV3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFV3 antibody: synthetic peptide directed towards the middle region of human NDUFV3. Synthetic peptide located within the following region: PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR |
Germany
Japan
United Kingdom
China
