Germany
Japan
United Kingdom
China
Rabbit Polyclonal Akt Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Akt |
Primary Antibodies
View as table Download
Rabbit Polyclonal c-Jun Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human c-Jun. |
Rabbit Polyclonal c-Jun (Ser63) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human c-Jun around the phosphorylation site of Sersine 63. |
| Modifications | Phospho-specific |
Rabbit Polyclonal erk1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human ERK1/2. |
Rabbit Polyclonal PDGFB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human PDGFB. |
Rabbit Polyclonal GLUT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human GLUT1. |
Rabbit Polyclonal N-RAS Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | N-RAS antibody was raised against a 15 amino acid peptide near the carboxy terminus of human N-RAS. |
Goat Anti-ARNT (aa558-570) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SEIYHNINADQSK, from the internal region of the protein sequence according to NP_001659.1; NP_848514.1; NP_001184254.1. |
Goat Anti-ARNT (aa69-82) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CNDKERFARSDDEQS, from the internal region (near N Terminus) of the protein sequence according to NP_001659.1;. |
Rabbit anti-HGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HGF |
Rabbit anti-pan-AKT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human pan-AKT |
Phospho- PIK3R1/2/3-Y467 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y467of human PIK3R1/2/3 |
Rabbit Polyclonal anti-Akt Phospho (Ser473) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Modified Synthetic peptide |
Anti-Human TGF-a Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human TGF-α |
Anti-Human VEGF Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human VEGF |
Anti-Human VEGF Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human VEGF |
Rabbit Polyclonal anti-ETS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ETS1 antibody is: synthetic peptide directed towards the middle region of Human ETS1. Synthetic peptide located within the following region: FQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNG |
Rabbit Polyclonal anti-CRKL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS |
Rabbit Polyclonal Anti-PIK3CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD |
Rabbit Polyclonal Anti-TCEB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the middle region of human TCEB1. Synthetic peptide located within the following region: AENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALE |
Rabbit Polyclonal Anti-TCEB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCEB1 antibody: synthetic peptide directed towards the N terminal of human TCEB1. Synthetic peptide located within the following region: EHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRY |
Rabbit Polyclonal Anti-CDC42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC42 antibody: synthetic peptide directed towards the N terminal of human CDC42. Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP |
Rabbit Polyclonal Anti-CUL2 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CUL2 antibody: synthetic peptide directed towards the middle region of human CUL2. Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA |
Rabbit Polyclonal Anti-PIK3CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE |
Rabbit Polyclonal Anti-PIK3R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIK3R3 antibody is: synthetic peptide directed towards the C-terminal region of Human PIK3R3. Synthetic peptide located within the following region: DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK |
Rabbit Polyclonal Anti-PIK3R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIK3R3 Antibody: synthetic peptide directed towards the middle region of human PIK3R3. Synthetic peptide located within the following region: EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE |
Rabbit Polyclonal Anti-ARAF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARAF antibody: synthetic peptide directed towards the middle region of human ARAF. Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW |
Rabbit Polyclonal Anti-HGF Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG |
Rabbit Polyclonal Anti-HGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HGF antibody: synthetic peptide directed towards the middle region of human HGF. Synthetic peptide located within the following region: NENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVI |
Rabbit Polyclonal Anti-EGLN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGLN2 Antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: SAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRL |
Rabbit Polyclonal Anti-RAP1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAP1B Antibody: synthetic peptide directed towards the N terminal of human RAP1B. Synthetic peptide located within the following region: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ |
Rabbit Polyclonal Anti-Rap1a Antibody
| Reactivities | Mouse, Human |
Rabbit Polyclonal Anti-EGLN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN3 antibody: synthetic peptide directed towards the C terminal of human EGLN3. Synthetic peptide located within the following region: FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT |
Rabbit Polyclonal Anti-VEGFC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD |
Rabbit Polyclonal Anti-RAP1A Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rap1a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rap1a. Synthetic peptide located within the following region: GQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKS |
Mouse monoclonal Anti-HIF2A Clone Hif2a 237
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti GLUT-1 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human Glut-1 Protein. This sequence is identical to human and rat. |
Rabbit anti ERK1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti TGF-alpha Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti TGF-beta 2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein. |
Rabbit anti TGF beta Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human TGF-beta protein. |
Rabbit anti ERK2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of ERK2 protein from human, rat, mouse and dog origins. |
Rabbit anti c-Jun Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of human c-Jun protein. This sequence is identical within human, rat, mouse, bovine and dog. |
Rabbit anti c-Met Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide from C-terminus of human c-Met protein |
Rabbit anti Raf -A Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A Synthetic peptide derived from N-term of Raf-A conjugated to KLH |
Rabbit anti P38 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human PID/MTA2. This sequence is identical within human, rat, mouse, bovine and dog origins. |
Rabbit anti Mek1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Mek2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Raf1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti PAK4(pS474) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope RKSLV-with a phosphorylation at Serine 474 of human PAK4. This sequence is also identical within human, rat, mouse, chicken, bovine and dog species. |
Active filters
Isotypes
- IgG
Pathways
- Renal cell carcinoma
Filter by
Category
Target Symbol
- AKT1 (51)
- JUN (26)
- BRAF (18)
- RAF1 (17)
- PTPN11 (16)
- MET (15)
- MAPK1 (14)
- PAK1 (13)
- MAP2K1 (12)
- HIF1A (11)
- MAPK3 (11)
- PDGFB (11)
- VEGFA (11)
- VEGFB (9)
- GAB1 (8)
- PGF (8)
- TGFB1 (8)
- AKT2 (7)
- ARNT (7)
- MAP2K2 (7)
- NRAS (7)
- PAK2 (7)
- PAK5 (7)
- PIK3R1 (7)
- TGFB2 (7)
- CREBBP (6)
- CUL2 (6)
- EP300 (6)
- FH (6)
- SLC2A1 (6)
- TGFA (6)
- AKT3 (5)
- EGLN1 (5)
- ETS1 (5)
- HGF (5)
- PAK4 (5)
- PIK3CD (5)
- RAP1A (5)
- VHL (5)
- ARAF (4)
- CDC42 (4)
- CRKL (4)
- EGLN3 (4)
- ELOC (4)
- GRB2 (4)
- PAK3 (4)
- PIK3CB (4)
- PIK3R3 (4)
- RAC1 (4)
- ARNT2 (3)
- CRK (3)
- EGLN2 (3)
- HRAS (3)
- PIK3CA (3)
- RAP1B (3)
- SOS2 (3)
- VEGFC (3)
- VEGFD (3)
- ELOB (2)
- EPAS1 (2)
- PIK3CG (2)
- TGFB3 (2)
- FLCN (1)
- KRAS (1)
- PAK6 (1)
- PAK7 (1)
- PIK3R2 (1)
- PIK3R5 (1)
- RAPGEF1 (1)
- RBX1 (1)
- SOS1 (1)