Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Anti-COX5B Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-139 amino acids of human cytochrome c oxidase subunit Vb |
Rabbit polyclonal ATP5J Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ATP5J antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-56 amino acids from the Central region of human ATP5J. |
Rabbit Polyclonal Anti-ND6 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ND6 antibody: synthetic peptide directed towards the middle region of human ND6. Synthetic peptide located within the following region: DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT |
Rabbit Polyclonal Anti-Atp6v0a1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH |
NDUFA4 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 51-100 of Human NDUFA4. |
ATP5MC1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 27-56 amino acids from the Central region of Human ATP5G1. |
USD 450.00
2 Weeks
Rabbit Polyclonal antibody to NDUFV2 (NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 249 of NDUFV2 (Uniprot ID#P19404) |
Rabbit Polyclonal antibody to NDUFV1 (NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 218 and 459 of NDUFV1 (Uniprot ID#P49821) |
Rabbit Polyclonal antibody to NDUFA5 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 116 of NDUFA5 (Uniprot ID#Q16718) |
Rabbit Polyclonal antibody to ATP synthase delta (ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 168 of ATP synthase delta (Uniprot ID#P30049) |
Rabbit Polyclonal antibody to NDUFB9 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 162 of NDUFB9 |
Rabbit polyclonal anti-COX5A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human COX5A. |
Rabbit polyclonal anti-ATP6V1H antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H. |
Rabbit polyclonal NDUFS7 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This NDUFS7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 119-146 amino acids from the Central region of human NDUFS7. |
Rabbit polyclonal Anti-ATP6V0D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0D2 antibody: synthetic peptide directed towards the middle region of human ATP6V0D2. Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI |
Rabbit Polyclonal Anti-ATP6V1B2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the middle region of human ATP6V1B2. Synthetic peptide located within the following region: NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK |
Rabbit Polyclonal Anti-ATP6V0A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A1 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A1. Synthetic peptide located within the following region: RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE |
Rabbit Polyclonal Anti-COX15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY |
Rabbit polyclonal Anti-NDUFA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFA9 antibody: synthetic peptide directed towards the N terminal of human NDUFA9. Synthetic peptide located within the following region: QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY |
COX4 (COX4I1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide surrounding amino acid 32 of human Cox IV. |
ATP12A (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ATP12A |
ATP5PO (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human ATP5O |
ATP6AP1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Canine, Equine, Human, Mouse, Rabbit, Rat |
| Immunogen | Synthetic peptide directed towards the middle region of human ATP6AP1 |
ATP5F1D (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 127-157 amino acids from the C-terminal region of human ATP5D |
ATP6V0C (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 107-134 amino acids from the C-terminal region of human ATP6V0C |
COX6A2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 44~74 amino acids from the Central region of human COX6A2 |
UQCRB (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 33-61 amino acids from the Central region of human UQCRB |
Active filters
Pathways
- Oxidative phosphorylation
Filter by
Category
Target Symbol
- ATP5F1B (53)
- ATP6V1C2 (52)
- NDUFA7 (51)
- NDUFB10 (39)
- COX6A1 (36)
- NDUFB9 (34)
- SDHB (33)
- COX17 (24)
- ATP6V1B1 (23)
- UQCRC1 (22)
- NDUFA4L2 (21)
- ATP6V1F (15)
- NDUFB3 (15)
- NDUFS2 (14)
- COX6C (12)
- ATP5ME (11)
- COX4I1 (11)
- ATP6V1B2 (8)
- UQCRFS1 (8)
- ATP5F1C (7)
- ATP6V0D2 (7)
- NDUFA5 (7)
- ATP5PO (6)
- COX6B2 (6)
- NDUFA2 (6)
- NDUFS1 (6)
- NDUFV2 (6)
- COX6B1 (5)
- NDUFA8 (5)
- NDUFA9 (5)
- NDUFS8 (5)
- PPA2 (5)
- ATP5F1A (4)
- ATP5F1D (4)
- ATP5PF (4)
- ATP6AP1 (4)
- COX10 (4)
- COX5B (4)
- NDUFA10 (4)
- NDUFA4 (4)
- NDUFS3 (4)
- NDUFS4 (4)
- PPA1 (4)
- SDHA (4)
- ATP5PB (3)
- ATP5PD (3)
- ATP6V1A (3)
- COX15 (3)
- COX4I2 (3)
- COX5A (3)
- COX6A2 (3)
- COX7A1 (3)
- COX7A2 (3)
- COX7B (3)
- CYC1 (3)
- NDUFA3 (3)
- NDUFC2 (3)
- NDUFS5 (3)
- NDUFS6 (3)
- NDUFS7 (3)
- NDUFV1 (3)
- ATP4B (2)
- ATP5MC1 (2)
- ATP5MC2 (2)
- ATP6V0A1 (2)
- ATP6V0A2 (2)
- ATP6V0B (2)
- ATP6V0C (2)
- ATP6V0D1 (2)
- ATP6V0E2 (2)
- ATP6V1H (2)
- COX11 (2)
- COX7B2 (2)
- LCMT2 (2)
- LHPP (2)
- MTND5 (2)
- NDUFA1 (2)
- NDUFA11 (2)
- NDUFA6 (2)
- NDUFAB1 (2)
- NDUFB5 (2)
- NDUFV3 (2)
- SDHD (2)
- TCIRG1 (2)
- UQCRB (2)
- UQCRC2 (2)
- ATP12A (1)
- ATP5E (1)
- ATP5MC3 (1)
- ATP5MF (1)
- ATP6V0A4 (1)
- ATP6V1C1 (1)
- ATP6V1D (1)
- ATP6V1E2 (1)
- ATP6V1G2 (1)
- ATP6V1G3 (1)
- COX7A2L (1)
- COX7C (1)
- COX8A (1)
- MTATP6 (1)