Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to STK24 (serine/threonine kinase 24 (STE20 homolog, yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 137 and 231 of MST3 (Uniprot ID#Q9Y6E0) |
Rabbit polyclonal antibody to H-Ras (v-Ha-ras Harvey rat sarcoma viral oncogene homolog)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 111 and 189 of H-Ras (Uniprot ID#P01112) |
Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249) |
Rabbit polyclonal antibody to NPR-C (natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 265 and 514 of NPR-C |
Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277) |
Rabbit Polyclonal antibody to KPNA4 (karyopherin alpha 4 (importin alpha 3))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 459 and 521 of KPNA4 (Uniprot ID#O00629) |
Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062) |
Rabbit polyclonal antibody to RBP-Jkappa (recombination signal binding protein for immunoglobulin kappa J region)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 258 and 500 of RBP-Jkappa (Uniprot ID#Q06330) |
Rabbit Polyclonal antibody to SUCLA2 (succinate-CoA ligase, ADP-forming, beta subunit)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 138 and 416 of SUCLA2 (Uniprot ID#Q9P2R7) |
Rabbit Polyclonal antibody to Transmembrane protein 147 (transmembrane protein 147)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 37 and 131 of Transmembrane protein 147 (Uniprot ID#Q9BVK8) |
Rabbit polyclonal TUBB2B Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TUBB2B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TUBB2B. |
Rabbit polyclonal PITX2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PITX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-151 amino acids from the C-terminal region of human PITX2. |
Rabbit polyclonal HAND2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HAND2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 81-110 amino acids from the Central region of human HAND2. |
Rabbit polyclonal TADA3L Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TADA3L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 386-414 amino acids from the C-terminal region of human TADA3L. |
Rabbit polyclonal YBX1 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This YBX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of human YBX1. |
Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB). |
Rabbit Polyclonal Anti-HLX Antibody
| Applications | IF, WB |
| Reactivities | Human, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLX1 antibody: synthetic peptide directed towards the middle region of human HLX1 (Cat# AAP31195). Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Xenopus
Applications
- IF
Antibody Hosts
- Rabbit
Isotypes
- IgG
Filter by
Target Symbol
- H2AFZ (2)
- HPRT1 (2)
- ACTA1 (1)
- ACTC1 (1)
- ARF3 (1)
- ATG5 (1)
- BHMT (1)
- C9ORF78 (1)
- CAPN5 (1)
- CKB (1)
- CKS2 (1)
- CNOT7 (1)
- CS (1)
- DDX39A (1)
- DEDD (1)
- DLST (1)
- DTX1 (1)
- EIPR1 (1)
- EN2 (1)
- ENO1 (1)
- FBXO43 (1)
- FOXG1 (1)
- GAPDH (1)
- GID8 (1)
- GLDC (1)
- GLI3 (1)
- GLO1 (1)
- HAND2 (1)
- HDAC1 (1)
- HLX (1)
- HRAS (1)
- IPO7 (1)
- ITPA (1)
- KPNA4 (1)
- KRR1 (1)
- MIB1 (1)
- MMP2 (1)
- NCS1 (1)
- NDUFAB1 (1)
- NEK7 (1)
- NOVA1 (1)
- NPR3 (1)
- NR2F1 (1)
- PCBP2 (1)
- PCCB (1)
- PGD (1)
- PIK3C3 (1)
- PITX2 (1)
- POLR3A (1)
- PPP1CB (1)
- PPP1CC (1)
- PRPS2 (1)
- PSMB8 (1)
- RAB6A (1)
- RAE1 (1)
- RBPJ (1)
- RFC4 (1)
- RPL13A (1)
- SEC13 (1)
- SEC61A1 (1)
- SERP1 (1)
- SNX12 (1)
- STK24 (1)
- SUCLA2 (1)
- TADA3L (1)
- TARDBP (1)
- TBCK (1)
- TBP (1)
- TMEM147 (1)
- TUBB (1)
- TUBB2B (1)
- TUBB4A (1)
- TUBG1 (1)
- UAP1 (1)
- UBE2L3 (1)
- VCP (1)
- VIM (1)
- WNT11 (1)
- YBX1 (1)
Clonalities
Conjugates
Families
- Druggable Genome (42)
- Transcription Factors (15)
- Stem cell - Pluripotency (6)
- ES Cell Differentiation/IPS (5)
- Transmembrane (5)
- Protease (3)
- Protein Kinase (3)
- Adult stem cells (2)
- Phosphatase (2)
- Cancer stem cells (1)
- Embryonic stem cells (1)
- GPCR (1)
- Nuclear Hormone Receptor (1)
- Secreted Protein (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
Pathways
- Metabolic pathways (18)
- Pathways in cancer (5)
- Purine metabolism (5)
- Gap junction (4)
- Citrate cycle (TCA cycle) (3)
- Drug metabolism - other enzymes (3)
- Focal adhesion (3)
- Huntington's disease (3)
- Insulin signaling pathway (3)
- Long-term potentiation (3)
- Notch signaling pathway (3)
- Oocyte meiosis (3)
- Pathogenic Escherichia coli infection (3)
- Regulation of actin cytoskeleton (3)
- Alzheimer's disease (2)
- Basal cell carcinoma (2)
- Bladder cancer (2)
- Chronic myeloid leukemia (2)
- Glycine (2)
- Glycolysis / Gluconeogenesis (2)
- GnRH signaling pathway (2)
- Hedgehog signaling pathway (2)
- Melanogenesis (2)
- Parkinson's disease (2)
- Pentose phosphate pathway (2)
- Propanoate metabolism (2)
- Pyrimidine metabolism (2)
- RNA degradation (2)
- Regulation of autophagy (2)
- Systemic lupus erythematosus (2)
- Vascular smooth muscle contraction (2)
- serine and threonine metabolism (2)
- Acute myeloid leukemia (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Arginine and proline metabolism (1)
- Axon guidance (1)
- B cell receptor signaling pathway (1)
- Basal transcription factors (1)
- Cardiac muscle contraction (1)
- Cell cycle (1)
- Chemokine signaling pathway (1)
- Cysteine and methionine metabolism (1)
- Cytosolic DNA-sensing pathway (1)
- DNA replication (1)
- Dilated cardiomyopathy (1)
- Endocytosis (1)
- Endometrial cancer (1)
- ErbB signaling pathway (1)
- Fc epsilon RI signaling pathway (1)
- Glioma (1)
- Glutathione metabolism (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Inositol phosphate metabolism (1)
- Leukocyte transendothelial migration (1)
- Long-term depression (1)
- Lysine degradation (1)
- MAPK signaling pathway (1)
- Melanoma (1)
- Mismatch repair (1)
- Natural killer cell mediated cytotoxicity (1)
- Neurotrophin signaling pathway (1)
- Non-small cell lung cancer (1)
- Nucleotide excision repair (1)
- Oxidative phosphorylation (1)
- Phosphatidylinositol signaling system (1)
- Prostate cancer (1)
- Proteasome (1)
- Pyruvate metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- RNA polymerase (1)
- Renal cell carcinoma (1)
- Ribosome (1)
- T cell receptor signaling pathway (1)
- TGF-beta signaling pathway (1)
- Thyroid cancer (1)
- Tight junction (1)
- Ubiquitin mediated proteolysis (1)
- VEGF signaling pathway (1)
- Valine (1)
- Vibrio cholerae infection (1)
- Wnt signaling pathway (1)
- leucine and isoleucine degradation (1)