Red Blood Cells rabbit polyclonal antibody, Purified
Applications | AGG, IHC |
Reactivities | Human |
Immunogen | Human washed pooled Red Blood Cells (RBC) |
Red Blood Cells rabbit polyclonal antibody, Purified
Applications | AGG, IHC |
Reactivities | Human |
Immunogen | Human washed pooled Red Blood Cells (RBC) |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Immunogen | Collagen type I purified from Human and Bovine placenta. |
Vaccinia Virus (Lister Strain) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC |
Immunogen | Lister Strain (mixture of virions and infected cell polypeptides) |
Lyve1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Mouse, Rat |
Immunogen | Highly pure (> 95%) recombinant Mouse soluble LYVE-1 (Ala24-Gly228) produced in insect cells (Cat.-No DA3524). |
Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH |
Symetric Dimethylarginine (SDMA) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, R, WB |
Immunogen | Symmetric Dimethylarginine (SDMA) KLH-conjugated. |
VIP rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mammalian |
Conjugation | Unconjugated |
Immunogen | Porcine VIP coupled to bovine thyroglobulin (BTg) with carbodiimide (CDI) linker. |
Candida albicans rabbit polyclonal antibody, Purified
Applications | ELISA, ID, Ie, IF, IHC |
Reactivities | Candida |
Immunogen | Candida albicans, type A (ATTCC #32354). |
Rabbit Polyclonal Antibody against LC3B
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of the human LC3, isoform B protein. |
Rabbit Polyclonal Antibody against GFAP (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
beta 2 Microglobulin (B2M) rabbit polyclonal antibody, HRP
Applications | ELISA, EM, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Immunogen | Beta-2-Microglobulin [Human Urine]. |
S1PR2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 281-330 of Human EDG-5. |
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mouse, Rat, Sheep |
Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Immunogen | Collagen type I purified from Human and Bovine placenta. |
Lyve1 rabbit polyclonal antibody, Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Mouse, Rat |
Immunogen | Highly pure recombinant Mouse soluble LYVE-1 (Ala24-Gly228) produced in insect cells (Cat.-No DA3524). This recombinant soluble LYVE-1 consists of amino acid 24 (Ala) to 228 (Gly) and is fused to a C-terminal His-tag (6xHis). |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
STAT3 pTyr705 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic phosphopeptide, sequence around phosphorylation site of Tyrosine 705 (A-P-Y(p)-L-K), and KLH conjugates. |
Rabbit Polyclonal Anti-NOX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4. |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Conjugation | Biotin |
Immunogen | Collagen Type I from Human and Bovine placenta. |
Rabbit Polyclonal PD-L1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
Modifications | Phospho-specific |
LYVE1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure recombinant Human soluble LYVE-1 produced in insect cells (Cat.-No DA3525). It consists of amino acid 24 (Ser) to 232 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Rabbit Polyclonal VLK Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
STAT3 pTyr705 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic phosphopeptide, sequence around phosphorylation site of Tyrosine 705 (A-P-Y(p)-L-K), and KLH conjugates. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
SNAIL (SNAI1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic phosphopeptide derived from human SNAI 1 around the phosphorylation site of Serine 246. |
Rabbit anti-Nono Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A specific peptide of human Nono |
Serotonin rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mammalian, Snail |
Oct4 (POU5F1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 200-250 of Human Oct-3/4. |
Rabbit Polyclonal Dact2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Dact2 antibody was raised against a 12 amino acid peptide from near the amino terminus of human DACT2. |
CD9 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 100-150 of Human CD9. |
SMAD4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 12-64 of Human Smad4. |
Borrelia burgdorferi rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Bacteria |
Immunogen | Whole cell preparation from B. burgdorferi (Strain: B31 ATCC#35210) |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | A. victoria |
Immunogen | Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-BDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor). |
Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
Nidogen-2 rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, R, WB |
Reactivities | Mouse |
Immunogen | Recombinant Mouse Nidogen 2 |
Sodium Iodide Symporter (SLC5A5) (C-term) rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human, Porcine, Rat |
Immunogen | Synthetic peptide from the C-terminus of Rat NIS |
Rabbit Polyclonal Lipase A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571] |
Rabbit anti-REG3A Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human REG3A |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Nidogen-2 rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, R, WB |
Reactivities | Mouse |
Immunogen | Recombinant Mouse Nidogen 2 |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
SEMA3G (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 216-244 amino acids from the Central region of Human SEMA3G |