Germany
Japan
United Kingdom
China
Antibodies
Download
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal Anti-NEU1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
Rabbit anti-SLC3A2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC3A2 |
Rabbit Polyclonal Anti-KLB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLB antibody: synthetic peptide directed towards the middle region of human KLB. Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG |
Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
USD 380.00
In Stock
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Rabbit Polyclonal Anti-SQLE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Families
- Transmembrane
Filter by
Target Symbol
- BAX (10)
- CXCR4 (10)
- TRPM8 (10)
- APP (9)
- BCL2 (8)
- EGFR (8)
- KDR (8)
- MUC1 (8)
- ACE2 (7)
- BDNF (7)
- GRIA2 (7)
- LGR5 (7)
- PTGS1 (7)
- TLR4 (7)
- AIFM1 (6)
- BCL2L1 (6)
- CD274 (6)
- CDH1 (6)
- CELSR3 (6)
- CSF1R (6)
- ENPP3 (6)
- FGFR3 (6)
- G6PC1 (6)
- GRM1 (6)
- MME (6)
- SCARB1 (6)
- TLR2 (6)
- TLR8 (6)
- TNF (6)
- ADRA1B (5)
- AGER (5)
- CD70 (5)
- CLDN1 (5)
- COX4I1 (5)
- CX3CR1 (5)
- DIABLO (5)
- ERBB2 (5)
- ERBB3 (5)
- FGFR2 (5)
- GRPR (5)
- HTR1F (5)
- HTR2B (5)
- ITGAX (5)
- KISS1R (5)
- MERTK (5)
- NGFR (5)
- NPHS1 (5)
- NPY1R (5)
- NTRK1 (5)
- PIGR (5)
- RTN4 (5)
- S1PR1 (5)
- SLC1A4 (5)
- SLC2A1 (5)
- SLC39A6 (5)
- STEAP4 (5)
- TLR3 (5)
- TNFSF13 (5)
- TRPA1 (5)
- TRPC3 (5)
- TRPC6 (5)
- TRPV4 (5)
- ADGRA2 (4)
- ADORA2A (4)
- ADRA1A (4)
- ADRB3 (4)
- APLNR (4)
- ATG9A (4)
- ATP7B (4)
- BAI2 (4)
- BNIP3L (4)
- BSG (4)
- CANX (4)
- CCR1 (4)
- CD151 (4)
- CD44 (4)
- CD8A (4)
- CDH3 (4)
- CDH5 (4)
- CDH8 (4)
- CELSR2 (4)
- CFTR (4)
- CHRM1 (4)
- CLDN5 (4)
- CLDN7 (4)
- CNR2 (4)
- CPT1A (4)
- CXCR2 (4)
- CXCR3 (4)
- CYP2D6 (4)
- CYP2E1 (4)
- DDR1 (4)
- EDA (4)
- EIF2AK3 (4)
- GJA1 (4)
- GJB6 (4)
- GPRC6A (4)
- GRIK1 (4)
- GRIN1 (4)
- GRM4 (4)
Reactivities
- Human (3300)
- Mouse (2040)
- Rat (1708)
- Monkey (240)
- Bovine (164)
- Gorilla (126)
- Dog (115)
- Rabbit (104)
- Hamster (96)
- Horse (95)
- Gibbon (94)
- Pig (87)
- Bat (85)
- Chicken (46)
- Chimpanzee (34)
- Xenopus (32)
- Orang-Utan (27)
- Guinea Pig (23)
- Primate (20)
- Zebrafish (19)
- Rhesus Monkey (18)
- Canine (7)
- Porcine (6)
- Macaque (5)
- Sheep (5)
- X. tropicalis (5)
- Cow (3)
- Drosophila (3)
- Equine (3)
- Feline (3)
- Avian (1)
- Goat (1)
- Mink (1)
- Opossum (1)
- Pufferfish (1)
- Quail (1)
Isotypes
Clonalities
Modifications
Pathways
- Neuroactive ligand-receptor interaction (397)
- Cytokine-cytokine receptor interaction (274)
- Metabolic pathways (201)
- Calcium signaling pathway (200)
- Pathways in cancer (196)
- Cell adhesion molecules (CAMs) (153)
- Endocytosis (115)
- Hematopoietic cell lineage (103)
- MAPK signaling pathway (95)
- Regulation of actin cytoskeleton (89)
- Alzheimer's disease (86)
- Focal adhesion (82)
- Leukocyte transendothelial migration (80)
- Chemokine signaling pathway (77)
- Colorectal cancer (74)
- Melanogenesis (68)
- Toll-like receptor signaling pathway (63)
- Gap junction (61)
- Amyotrophic lateral sclerosis (ALS) (58)
- Apoptosis (57)
- Jak-STAT signaling pathway (57)
- Dilated cardiomyopathy (56)
- Adherens junction (55)
- Vascular smooth muscle contraction (55)
- Wnt signaling pathway (54)
- Axon guidance (51)
- Basal cell carcinoma (50)
- Neurotrophin signaling pathway (49)
- Adipocytokine signaling pathway (48)
- Huntington's disease (47)
- Hypertrophic cardiomyopathy (HCM) (46)
- Natural killer cell mediated cytotoxicity (45)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (44)
- Prostate cancer (44)
- ABC transporters (43)
- Pancreatic cancer (42)
- ECM-receptor interaction (41)
- Lysosome (37)
- Hedgehog signaling pathway (36)
- Melanoma (36)
- Tight junction (36)
- Long-term potentiation (35)
- ErbB signaling pathway (34)
- Parkinson's disease (34)
- TGF-beta signaling pathway (34)
- Antigen processing and presentation (33)
- PPAR signaling pathway (32)
- Bladder cancer (30)
- GnRH signaling pathway (30)
- Long-term depression (29)
- Pathogenic Escherichia coli infection (29)
- Small cell lung cancer (29)
- Drug metabolism - cytochrome P450 (28)
- Purine metabolism (27)
- Renin-angiotensin system (27)
- Viral myocarditis (26)
- Cardiac muscle contraction (25)
- Complement and coagulation cascades (25)
- Epithelial cell signaling in Helicobacter pylori infection (25)
- Graft-versus-host disease (25)
- Metabolism of xenobiotics by cytochrome P450 (25)
- Retinol metabolism (24)
- Arachidonic acid metabolism (23)
- Chronic myeloid leukemia (23)
- Glioma (23)
- Systemic lupus erythematosus (23)
- Type I diabetes mellitus (23)
- Allograft rejection (22)
- Endometrial cancer (22)
- Notch signaling pathway (22)
- Starch and sucrose metabolism (21)
- T cell receptor signaling pathway (21)
- Taste transduction (21)
- Type II diabetes mellitus (21)
- Autoimmune thyroid disease (20)
- Oxidative phosphorylation (20)
- p53 signaling pathway (20)
- Non-small cell lung cancer (19)
- Primary immunodeficiency (19)
- Fatty acid metabolism (18)
- N-Glycan biosynthesis (18)
- Renal cell carcinoma (18)
- SNARE interactions in vesicular transport (18)
- Oocyte meiosis (17)
- Prion diseases (17)
- Androgen and estrogen metabolism (15)
- Progesterone-mediated oocyte maturation (14)
- RIG-I-like receptor signaling pathway (14)
- Sphingolipid metabolism (14)
- Vibrio cholerae infection (14)
- Asthma (13)
- Linoleic acid metabolism (13)
- Porphyrin and chlorophyll metabolism (13)
- Thyroid cancer (13)
- Dorso-ventral axis formation (12)
- Drug metabolism - other enzymes (12)
- Insulin signaling pathway (12)
- Nicotinate and nicotinamide metabolism (12)
- Tryptophan metabolism (12)
- B cell receptor signaling pathway (11)
- Biosynthesis of unsaturated fatty acids (11)
- Glycerolipid metabolism (11)
- Olfactory transduction (11)
- Riboflavin metabolism (11)
- Tyrosine metabolism (11)
- Fc gamma R-mediated phagocytosis (10)
- Glutathione metabolism (10)
- Glycerophospholipid metabolism (10)
- Glycolysis / Gluconeogenesis (10)
- NOD-like receptor signaling pathway (10)
- O-Glycan biosynthesis (10)
- Ascorbate and aldarate metabolism (9)
- Chondroitin sulfate biosynthesis (9)
- Cytosolic DNA-sensing pathway (9)
- Glycosphingolipid biosynthesis - lacto and neolacto series (9)
- Acute myeloid leukemia (8)
- Galactose metabolism (8)
- Pyrimidine metabolism (8)
- VEGF signaling pathway (8)
- Ether lipid metabolism (7)
- Heparan sulfate biosynthesis (7)
- Pentose and glucuronate interconversions (7)
- Primary bile acid biosynthesis (7)
- C21-Steroid hormone metabolism (6)
- Fc epsilon RI signaling pathway (6)
- Keratan sulfate biosynthesis (6)
- Pantothenate and CoA biosynthesis (6)
- Propanoate metabolism (6)
- Valine (6)
- leucine and isoleucine degradation (6)
- Arginine and proline metabolism (5)
- Cell cycle (5)
- Glycosphingolipid biosynthesis - ganglio series (5)
- Glycosphingolipid biosynthesis - globo series (5)
- Histidine metabolism (5)
- Steroid biosynthesis (5)
- Caffeine metabolism (4)
- Glycosaminoglycan degradation (4)
- Inositol phosphate metabolism (4)
- Phosphatidylinositol signaling system (4)
- Ubiquitin mediated proteolysis (4)
- beta-Alanine metabolism (4)
- Butanoate metabolism (3)
- Cyanoamino acid metabolism (3)
- Glycine (3)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (3)
- Limonene and pinene degradation (3)
- Lysine degradation (3)
- Nitrogen metabolism (3)
- Phenylalanine metabolism (3)
- Pyruvate metabolism (3)
- Selenoamino acid metabolism (3)
- Taurine and hypotaurine metabolism (3)
- serine and threonine metabolism (3)
- Maturity onset diabetes of the young (2)
- Other glycan degradation (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Base excision repair (1)
- O-Mannosyl glycan biosynthesis (1)
- Sulfur metabolism (1)
- Terpenoid backbone biosynthesis (1)