Antibodies

View as table Download

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit anti-PRKCA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human PRKCA

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit Polyclonal Anti-JUN Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human JUN

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Phospho-SRC-Y418 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y418 of human SRC
Modifications Phospho-specific

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K).
Modifications Phospho-specific

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific

Rabbit Polyclonal Akt1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit anti-AKT1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AKT1

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal Akt (Ab-129) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A).

Rabbit polyclonal Akt (Ab-326) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R).

Rabbit polyclonal JUN Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN.

Rabbit polyclonal c-Jun (Phospho-Ser63) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63.
Modifications Phospho-specific

Rabbit polyclonal STAT5B (Ser731) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human STAT5B around the phosphorylation site of serine 731 (A-P-SP-P-A).
Modifications Phospho-specific

Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).

Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Thr693, Mouse: Thr695, Rat: Thr694
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S).
Modifications Phospho-specific

Rabbit polyclonal Src (Ab-529) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Src around the phosphorylation site of tyrosine 529.

Rabbit polyclonal Src (Tyr529) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Src around the phosphorylation site of tyrosine 529 (P-Q-YP-Q-P).
Modifications Phospho-specific

Rabbit polyclonal Akt (Thr450) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AKT1 around the phosphorylation site of threonine 450 (T-I-TP-P-P).
Modifications Phospho-specific

Rabbit polyclonal Akt(Ab-473) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of Serine 473.

Rabbit polyclonal STAT5B (Ab-731) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human STAT5B around the phosphorylation site of serine 731(A-P-S-P-A).

Anti-SRC (Phospho-Tyr529) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 529 (P-Q-Y(p)-Q-P) derived from Human Src.
Modifications Phospho-specific

Rabbit polyclonal BTC Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This BTC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 17-45 amino acids from the N-terminal region of human BTC.

Rabbit polyclonal Phospho-cJun(S63) Antibody

Applications Dot, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun.
Modifications Phospho-specific

Rabbit polyclonal AKT2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 416-444 amino acids from the C-terminal region of human AKT2.

Rabbit polyclonal c-Jun (Phospho-Ser243) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243 (P-L-SP-P-I).
Modifications Phospho-specific

Rabbit polyclonal PIK3CG antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIK3CG.

Rabbit polyclonal c-Jun (Ab-170) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Tyrosine 170.

Rabbit polyclonal AKT1/2/3 (Tyr315/316/312) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).
Modifications Phospho-specific

Rabbit polyclonal anti-EGFR antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR.

Rabbit polyclonal AKT pS473 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to the C-terminus aa 460-480 of human, mouse, rat and chicken AKT proteins conjugated to KLH.

Rabbit polyclonal anti-AKT antibody

Applications IF, IHC, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AKT Antibody was produced from whole rabbit serum prepared by repeated immunizations with a synthetic peptide C-R-P-H-F-P-Q-F-S-Y-S-A-S-G-T-A corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling.

Anti-AKT1/AKT2/AKT3 (phospho-Tyr315/316/312) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 315/316/312 (P-E-Y(p)-L-A) derived from Human AKT1/AKT2/AKT3.
Modifications Phospho-specific

Anti-AKT1 (phospho-Thr450) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 450 (T-I-T(p)-P-P) derived from Human AKT1.
Modifications Phospho-specific

Rabbit polyclonal Phospho-cJun(S63) Antibody

Applications Dot, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun.
Modifications Phospho-specific

Rabbit polyclonal Phospho-STAT5a(Y694) Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This STAT5a Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y694 of human STAT5a.
Modifications Phospho-specific

Rabbit polyclonal EGFR-S1026 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026.

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.

Rabbit polyclonal EGFR Antibody (S1070)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This EGFR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1048-1077 amino acids from human EGFR.

Rabbit polyclonal c-Jun (Ab-243) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243.

Rabbit Polyclonal Anti-JUN Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP

PKC alpha (PRKCA) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to the C-terminal of human PKCa

AKT3 (119-136) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated, Synthetic peptide

Rabbit Polyclonal antibody to PKC alpha (protein kinase C, alpha)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 250 of PKC alpha (Uniprot ID#P17252)

Rabbit anti-STAT5A (Phospho-Ser780) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of serine 780 (R-L-SP-P-P).
Modifications Phospho-specific

Rabbit polyclonal Akt (Ab-450) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of threonine 450 (T-I-TP-P-P).