Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit polyclonal KLF5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal AXIN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AXIN2 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human AXIN2. The immunogen is located within amino acids 780 - 830 of AXIN2. |
Rabbit polyclonal Transcription Factor 3 / E2A (Thr355) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human E2A around the phosphorylation site of threonine 355 (P-S-TP-P-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal FOXA2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit anti SOX-2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of Human SOX-2 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
Rabbit polyclonal anti-Transcription Factor 3 (E2A Immunoglobulin Enhancer Binding Factors E12/E47) antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human E2A. |
Anti-PDX1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1 |
Anti-SOX2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human SRY (sex determining region Y)-box 2 |
Anti-DPPA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 92-298 amino acids of human developmental pluripotency associated 2 |
Anti-FGF4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 192-206 amino acids of Human fibroblast growth factor 4 |
Anti-KLF5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 107-119 amino acids of Human Kruppel-like factor 5 (intestinal) |
Anti-BMP4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
Anti-BDNF Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor |
Active filters
Reactivities
- Mouse
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Induced pluripotent stem cells
Filter by
Category
Target Symbol
Clonalities
Conjugates
Modifications
Pathways
- Pathways in cancer (14)
- MAPK signaling pathway (13)
- Endometrial cancer (8)
- TGF-beta signaling pathway (8)
- Wnt signaling pathway (8)
- Basal cell carcinoma (7)
- Bladder cancer (6)
- Colorectal cancer (6)
- ErbB signaling pathway (6)
- Hedgehog signaling pathway (6)
- Huntington's disease (6)
- Maturity onset diabetes of the young (6)
- Neurotrophin signaling pathway (6)
- Acute myeloid leukemia (5)
- Cell cycle (4)
- Chronic myeloid leukemia (4)
- Cytokine-cytokine receptor interaction (4)
- Jak-STAT signaling pathway (4)
- Melanoma (4)
- Regulation of actin cytoskeleton (4)
- Small cell lung cancer (4)
- Thyroid cancer (4)
- Endocytosis (3)
- Focal adhesion (3)
- Gap junction (3)
- Hematopoietic cell lineage (3)
- Melanogenesis (3)
- Prostate cancer (3)
- Type II diabetes mellitus (3)
- Glioma (2)
- Non-small cell lung cancer (2)
- Pancreatic cancer (2)
- Antigen processing and presentation (1)
- Calcium signaling pathway (1)
- Cell adhesion molecules (CAMs) (1)
- Metabolic pathways (1)
- Nicotinate and nicotinamide metabolism (1)
- Primary immunodeficiency (1)
- T cell receptor signaling pathway (1)