Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal anti-TCF7L1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF7L1. |
Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser392) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 392 |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 (Phospho-Ser15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-p53-Acetylated (Lys382) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Modified peptide |
Rabbit anti-NCOA4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NCOA4 |
Rabbit Polyclonal Anti-RXRG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL |
Rabbit Polyclonal Anti-RXRB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF7. Synthetic peptide located within the following region: AGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE |
Rabbit Polyclonal Anti-PAX8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PAX8 antibody is: synthetic peptide directed towards the middle region of Human PAX8. Synthetic peptide located within the following region: YSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFS |
Rabbit Polyclonal Anti-PAX8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the N terminal of human PAX8. Synthetic peptide located within the following region: KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD |
Rabbit Polyclonal Anti-MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit polyclonal Catenin-beta (Ab-489) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Anti-TCF7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-268 amino acids of human transcription factor 7 (T-cell specific, HMG-box) |
Rabbit polyclonal Phospho-p53(T18) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Catenin-β Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin-β |
Rabbit Polyclonal Catenin- beta (Ser33) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Serine 33 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Catenin- beta (Tyr489) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Tyrosine 489 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Catenin-β (Ser37) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin-β around the phosphorylation site of Serine 37 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser315) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 315 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser366) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 366 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser46) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 46 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser9) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 9 |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p53. |
Germany
Japan
United Kingdom
China
