Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
Rabbit Polyclonal antibody to UBE2L3 (ubiquitin-conjugating enzyme E2L 3)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 92 and 154 of UBE2L3 (Uniprot ID#P68036) |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit Polyclonal antibody to alpha Tubulin (tubulin, alpha 1b)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 118 and 365 of alpha Tubulin (Uniprot ID#P68363) |
Rabbit polyclonal KLF9 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-57 amino acids from the N-terminal region of human KLF9. |
Rabbit polyclonal JUN Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Rabbit polyclonal TSH2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TSH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 232-261 amino acids from the N-terminal region of human TSH2. |
Rabbit polyclonal SMAD4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
Rabbit polyclonal SCAP Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 604-632 amino acids from the Central region of human SCAP. |
Rabbit Polyclonal Antibody against GNB2L1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GNB2L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human GNB2L1. |
Rabbit polyclonal antibody to NHP2-like protein 1 (NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 128 of NHP2-like protein 1 (Uniprot ID#P55769) |
Rabbit polyclonal antibody to GAL3ST1 (galactose-3-O-sulfotransferase 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 412 of GAL3ST1 (Uniprot ID#Q99999) |
Rabbit Polyclonal antibody to CSE1L (CSE1 chromosome segregation 1-like (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 222 and 469 of CSE1L (Uniprot ID#P55060) |
Rabbit polyclonal antibody to TGF beta Receptor III (transforming growth factor, beta receptor III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 88 and 314 of TGF beta Receptor III (Uniprot ID#Q03167) |
Rabbit polyclonal antibody to hnRNP C1/C2 (heterogeneous nuclear ribonucleoprotein C (C1/C2))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 142 of hnRNP C1/C2 |
Rabbit polyclonal anti-ACTA1(alpha Actin, skeletal muscle) antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 377 of alpha Actin (skeletal muscle) |
Rabbit Polyclonal antibody to alpha Actin (cardiac muscle) (actin, alpha, cardiac muscle 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 99 and 354 of alpha Actin (cardiac muscle) (Uniprot ID#P68032) |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Rabbit polyclonal GALNS Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GALNS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-263 amino acids from the Central region of human GALNS. |
Rabbit polyclonal SUMO1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SUMO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human SUMO1. |
Rabbit polyclonal ACTA1/Alpha-actin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACTA1/Alpha-actin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 346-375 amino acids from the C-terminal region of human ACTA1/Alpha-actin. |
Rabbit polyclonal ATG5 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ATG5. |
Rabbit polyclonal UCHL1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This UCHL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the C-terminal region of human UCHL1. |
Rabbit polyclonal Vimentin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 430-457 amino acids from the C-terminal region of human Vimentin. |
Rabbit polyclonal ARGBP2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARGBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 175-204 amino acids from the N-terminal region of human ARGBP2. |
Rabbit polyclonal GAPDH Antibody (C-term R248)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 233-259 amino acids from the C-terminal region of human GAPDH. |
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Rabbit Polyclonal Anti-Claudin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
Rabbit Polyclonal Antibody against FGF1 (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-30 amino acids from the N-terminal region of human FGF1. |
Rabbit Polyclonal Antibody against KITLG (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCF (KITLG) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human SCF (KITLG). |
Rabbit Polyclonal Antibody against NCOA1 (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SRC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-214 amino acids from the N-terminal region of human SRC1. |
Rabbit Polyclonal antibody to DLST (dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 188 and 453 of DLST (Uniprot ID#P36957) |
Rabbit Polyclonal antibody to ERH (enhancer of rudimentary homolog (Drosophila))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 86 of ERH |
Active filters
Reactivities
- Pig
Applications
- WB
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Filter by
Category
Target Symbol
- MEF2C (4)
- ACTA1 (3)
- HSPA1A (3)
- MYC (3)
- SMAD3 (3)
- APP (2)
- CFL2 (2)
- DCN (2)
- DUSP6 (2)
- GAD2 (2)
- GAPDH (2)
- GNAS (2)
- GPR4 (2)
- H2AFZ (2)
- HPRT1 (2)
- JUN (2)
- NRAS (2)
- OGT (2)
- PCBP2 (2)
- RAC1 (2)
- STK26 (2)
- TP53 (2)
- TPT1 (2)
- AAPK1 (1)
- ACAD8 (1)
- ACTC1 (1)
- ACY1 (1)
- ADAP1 (1)
- ADRA1A (1)
- AIF1 (1)
- AKT2 (1)
- AMPH (1)
- AMY1A (1)
- ANXA1 (1)
- APEX1 (1)
- ARAF (1)
- ARF3 (1)
- ARF5 (1)
- ARPC2 (1)
- ASPA (1)
- ATG5 (1)
- ATIC (1)
- ATP6V1H (1)
- ATXN3 (1)
- BHMT (1)
- BIVM (1)
- BMPR2 (1)
- C2 (1)
- C5 (1)
- CALB2 (1)
- CAMK2D (1)
- CANX (1)
- CAPN1 (1)
- CAPZB (1)
- CAV2 (1)
- CCT2 (1)
- CD247 (1)
- CD40 (1)
- CD70 (1)
- CHMP5 (1)
- CKB (1)
- CLDN14 (1)
- CLDN5 (1)
- COX5B (1)
- CPS1 (1)
- CS (1)
- CSE1L (1)
- CSNK2B (1)
- DEFB129 (1)
- DKK3 (1)
- DLST (1)
- DNPEP (1)
- EIPR1 (1)
- EPHX1 (1)
- ERG (1)
- ERH (1)
- ESD (1)
- ESR1 (1)
- ESR2 (1)
- ETFB (1)
- F9 (1)
- FASN (1)
- FAU (1)
- FGF1 (1)
- FMO1 (1)
- FOXO1 (1)
- FPGT (1)
- FSCN1 (1)
- FTCD (1)
- FYN (1)
- GADD45G (1)
- GAL3ST1 (1)
- GALNS (1)
- GANAB (1)
- GBA (1)
- GOT2 (1)
- GPX2 (1)
- GSTA2 (1)
- HK2 (1)
- HMGA2 (1)
Conjugates
Modifications
Families
- Druggable Genome (150)
- Transcription Factors (36)
- Transmembrane (28)
- Secreted Protein (20)
- Stem cell - Pluripotency (17)
- ES Cell Differentiation/IPS (15)
- Protein Kinase (13)
- Protease (12)
- Embryonic stem cells (8)
- Stem cell relevant signaling - JAK/STAT signaling pathway (8)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (7)
- Phosphatase (6)
- Cancer stem cells (4)
- GPCR (4)
- Nuclear Hormone Receptor (4)
- Induced pluripotent stem cells (3)
- Stem cell relevant signaling - Wnt Signaling pathway (3)
- Adult stem cells (2)
Pathways
- Metabolic pathways (44)
- Pathways in cancer (26)
- MAPK signaling pathway (25)
- Colorectal cancer (16)
- Wnt signaling pathway (16)
- Chronic myeloid leukemia (15)
- Neurotrophin signaling pathway (12)
- Pancreatic cancer (12)
- TGF-beta signaling pathway (12)
- Acute myeloid leukemia (11)
- Cell cycle (11)
- ErbB signaling pathway (11)
- Insulin signaling pathway (10)
- Regulation of actin cytoskeleton (10)
- Adherens junction (9)
- B cell receptor signaling pathway (9)
- Endometrial cancer (9)
- Jak-STAT signaling pathway (9)
- T cell receptor signaling pathway (9)
- Alzheimer's disease (8)
- Axon guidance (8)
- Bladder cancer (8)
- Chemokine signaling pathway (8)
- Epithelial cell signaling in Helicobacter pylori infection (8)
- Fc epsilon RI signaling pathway (8)
- Fc gamma R-mediated phagocytosis (8)
- Focal adhesion (8)
- GnRH signaling pathway (8)
- Natural killer cell mediated cytotoxicity (8)
- Prostate cancer (8)
- Renal cell carcinoma (8)
- Small cell lung cancer (8)
- Thyroid cancer (8)
- Toll-like receptor signaling pathway (8)
- Glioma (7)
- Huntington's disease (7)
- Melanoma (7)
- Non-small cell lung cancer (7)
- Tight junction (7)
- Vascular smooth muscle contraction (7)
- Amyotrophic lateral sclerosis (ALS) (6)
- Arginine and proline metabolism (6)
- Gap junction (6)
- Glycolysis / Gluconeogenesis (6)
- Melanogenesis (6)
- Systemic lupus erythematosus (6)
- VEGF signaling pathway (6)
- Adipocytokine signaling pathway (5)
- Alanine (5)
- Apoptosis (5)
- Calcium signaling pathway (5)
- Cytokine-cytokine receptor interaction (5)
- Leukocyte transendothelial migration (5)
- Long-term depression (5)
- Long-term potentiation (5)
- NOD-like receptor signaling pathway (5)
- Parkinson's disease (5)
- Prion diseases (5)
- Ribosome (5)
- aspartate and glutamate metabolism (5)
- Antigen processing and presentation (4)
- Citrate cycle (TCA cycle) (4)
- Dilated cardiomyopathy (4)
- Lysosome (4)
- Oxidative phosphorylation (4)
- Pathogenic Escherichia coli infection (4)
- Progesterone-mediated oocyte maturation (4)
- Proteasome (4)
- Purine metabolism (4)
- Spliceosome (4)
- Vibrio cholerae infection (4)
- Viral myocarditis (4)
- Amino sugar and nucleotide sugar metabolism (3)
- Cell adhesion molecules (CAMs) (3)
- Complement and coagulation cascades (3)
- Endocytosis (3)
- Fructose and mannose metabolism (3)
- One carbon pool by folate (3)
- Oocyte meiosis (3)
- PPAR signaling pathway (3)
- RIG-I-like receptor signaling pathway (3)
- Regulation of autophagy (3)
- p53 signaling pathway (3)
- Basal cell carcinoma (2)
- Butanoate metabolism (2)
- Cardiac muscle contraction (2)
- Cysteine and methionine metabolism (2)
- Drug metabolism - cytochrome P450 (2)
- Drug metabolism - other enzymes (2)
- Galactose metabolism (2)
- Glutathione metabolism (2)
- Glycine (2)
- Histidine metabolism (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Neuroactive ligand-receptor interaction (2)
- O-Glycan biosynthesis (2)
- Phenylalanine metabolism (2)
- Primary immunodeficiency (2)
- Pyrimidine metabolism (2)
- Sphingolipid metabolism (2)
- Starch and sucrose metabolism (2)
- Taste transduction (2)
- Taurine and hypotaurine metabolism (2)
- Type I diabetes mellitus (2)
- Type II diabetes mellitus (2)
- Tyrosine metabolism (2)
- Ubiquitin mediated proteolysis (2)
- Valine (2)
- beta-Alanine metabolism (2)
- leucine and isoleucine degradation (2)
- mTOR signaling pathway (2)
- serine and threonine metabolism (2)
- Allograft rejection (1)
- Arachidonic acid metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Base excision repair (1)
- Biosynthesis of unsaturated fatty acids (1)
- Cytosolic DNA-sensing pathway (1)
- Fatty acid biosynthesis (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycosaminoglycan degradation (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Hematopoietic cell lineage (1)
- Inositol phosphate metabolism (1)
- Limonene and pinene degradation (1)
- Lipoic acid metabolism (1)
- Lysine degradation (1)
- Maturity onset diabetes of the young (1)
- N-Glycan biosynthesis (1)
- Nitrogen metabolism (1)
- Olfactory transduction (1)
- Other glycan degradation (1)
- Pentose phosphate pathway (1)
- Phenylalanine (1)
- Phosphatidylinositol signaling system (1)
- Propanoate metabolism (1)
- Pyruvate metabolism (1)
- RNA polymerase (1)
- Sulfur metabolism (1)
- tyrosine and tryptophan biosynthesis (1)