Rabbit anti-HSP90AB1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSP90AB1 |
Rabbit anti-HSP90AB1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSP90AB1 |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
Modifications | Phospho-specific |
CCNB1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CCNB1 |
Rabbit monoclonal antibody against Cdc25C(E302)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal HSP90B (Ab-254) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Rabbit polyclonal Cyclin B1 (Ab-126) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 126 (T-A-S-P-S). |
Rabbit polyclonal anti-Cyclin A antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Anti-Cyclin-A Antibody was produced by repeated immunizations with a recombinant protein corresponding to the human cyclin A. |
CDC25C Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDC25C |
Rabbit Polyclonal Cyclin B1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal Cyclin B1 (Ser147) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 147 (A-F-SP-D-V). |
Modifications | Phospho-specific |
Rabbit polyclonal CDC2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC2. |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP |
Rabbit Polyclonal Anti-CDC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 Antibody: A synthesized peptide derived from human CDC2 |
Rabbit Polyclonal Anti-HSP90B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSP90B Antibody: A synthesized peptide derived from human HSP90B |
Rabbit Polyclonal Anti-Phospho-HSP90B (Ser254) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-HSP90B (Ser254) Antibody: A synthesized peptide derived from human HSP90B around the phosphorylation site of Serine 254 |
Modifications | Phospho-specific |
Rabbit Polyclonal Cyclin A2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Cyclin B2 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Modifications | Phospho-specific |
Anti-CCNB1 (phospho-Ser147) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of Serine 147 (A-F-S(p)-D-V) derived from Human Cyclin B1. |
Modifications | Phospho-specific |
Anti-CDC25C Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.214~218 (S-P-S-M-P) derived from Human cdc25C. |
Rabbit polyclonal HSP90AB1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1. |
Rabbit polyclonal HSP90AB1 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-465 amino acids from the Central region of human HSP90AB1. |
Rabbit Polyclonal Cyclin B1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin B1 |
Rabbit Polyclonal Cyclin B1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin B1 |
Rabbit Polyclonal Cyclin B1 (Ser126) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin B1 around the phosphorylation site of Serine 126 |
Modifications | Phospho-specific |
Rabbit Polyclonal CDC25C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25C |
Rabbit Polyclonal CDC25C (Ser216) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25C around the phosphorylation site of Serine 216 |
Modifications | Phospho-specific |
Rabbit Polyclonal CDC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC2 |
Rabbit Polyclonal CDC2 (Tyr15) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC2 around the phosphorylation site of Tyrosine 15 |
Modifications | Phospho-specific |
Rabbit Polyclonal HSP90B (Ser254) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HSP90B around the phosphorylation site of Serine 254 |
Modifications | Phospho-specific |
Rabbit polyclonal CDC2 (Ab-161) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC2 around the phosphorylation site of Threonine161. |
Rabbit Polyclonal HSP90B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HSP90B |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit Polyclonal HSP90 beta Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human Hsp90B protein (between residues 650-724) [UniProt P08238] |
Rabbit Polyclonal Antibody against CDC2 (T14)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Rabbit Polyclonal Antibody against CDC2 (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human CDC2. |
Rabbit Polyclonal APC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | APC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human APC1. |
Rabbit Polyclonal anti-HSP90AB1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human Hsp90beta. |
Rabbit polyclonal Cyclin B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Anti-Cyclin B1 antibody was produced by repeated immunizations of full length fusion protein corresponding to the human gene. |
Rabbit polyclonal APC1 phospho S377 antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 373-382 of Human Apc1 protein. |
Modifications | Phospho-specific |
Rabbit Polyclonal Cyclin B1 (Ser147) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin B1 around the phosphorylation site of Serine 147 |
Modifications | Phospho-specific |
Rabbit polyclonal Hsp90 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length protein Hsp90 |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the N terminal of human CDC2. Synthetic peptide located within the following region: EDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIRE |
Rabbit anti CDC2 (pY15) (CDK1) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- with a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Rabbit anti CDC2 (Paired Y15) (CDK1) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- without a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Rabbit anti CDC2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins |
Rabbit Polyclonal Antibody against CDC2 (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 213-241 amino acids from the C-terminal region of human CDC2. |
Rabbit anti-HSP90B (Phospho-Ser254) polyclonal antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Modifications | Phospho-specific |