Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398) |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit Polyclonal antibody to VPS35 (vacuolar protein sorting 35 homolog (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 733 and 796 of VPS35 (Uniprot ID#Q96QK1) |
Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062) |
Rabbit Polyclonal antibody to PSMC6 (proteasome (prosome, macropain) 26S subunit, ATPase, 6)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 301 of PSMC6 (Uniprot ID#P62333) |
Rabbit Polyclonal antibody to SUCLA2 (succinate-CoA ligase, ADP-forming, beta subunit)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 138 and 416 of SUCLA2 (Uniprot ID#Q9P2R7) |
Rabbit Polyclonal antibody to Transmembrane protein 147 (transmembrane protein 147)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 37 and 131 of Transmembrane protein 147 (Uniprot ID#Q9BVK8) |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Rabbit polyclonal MAPK14 Antibody (Center T180/Y182)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-192 amino acids from the Central region of human MAPK14. |
Rabbit polyclonal PITX2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PITX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-151 amino acids from the C-terminal region of human PITX2. |
Rabbit polyclonal VPS26A Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This VPS26A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-291 amino acids from the Central region of human VPS26A. |
Rabbit polyclonal Anti-RAB5B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5B antibody: synthetic peptide directed towards the N terminal of human RAB5B. Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE |
Rabbit Polyclonal Antibody against MAT2 alpha
| Applications | WB |
| Reactivities | Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153] |
Rabbit Polyclonal antibody to LIMCH1 (LIM and calponin homology domains 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 734 and 1007 of LIMCH1 (Uniprot ID#Q9UPQ0) |
Rabbit polyclonal antibody to ACAD8 (acyl-Coenzyme A dehydrogenase family, member 8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 415 of ACAD8 (Uniprot ID#Q9UKU7) |
Rabbit polyclonal antibody to eIF2B beta (eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 88 and 323 of EIF2B beta (Uniprot ID#P49770) |
Rabbit Polyclonal antibody to TCP1 theta (chaperonin containing TCP1, subunit 8 (theta))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 111 and 367 of TCP1 theta (Uniprot ID#P50990) |
Rabbit Polyclonal antibody to GNAT2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 154 and 354 of GNAT2 (Uniprot ID#P19087) |
Rabbit polyclonal antibody to Sec61 gamma subunit (Sec61 gamma subunit)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 2 and 66 of Sec61 gamma |
Rabbit polyclonal anti-SMAD3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit polyclonal TADA3L Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TADA3L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 386-414 amino acids from the C-terminal region of human TADA3L. |
Rabbit polyclonal DMRTA2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | This DMRTA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 487-515 amino acids from the C-terminal region of human DMRTA2. |
Rabbit polyclonal AGR2 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AGR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 95-124 amino acids from the Central region of human AGR2. |
Rabbit Polyclonal anti-FOSL2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY |
Rabbit Polyclonal Anti-GSR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
Rabbit Polyclonal Anti-NOLC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOLC1 antibody: synthetic peptide directed towards the C terminal of human NOLC1. Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ |
Rabbit polyclonal Anti-RAB5A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
Rabbit Polyclonal Antibody against MAT1/2 alpha
| Applications | WB |
| Reactivities | Human, Rat, Bovine, Zebrafish, Orang-Utan, Monkey (Does not react with: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human MAT2A protein (within residues 100-200). [Swiss-Prot# P31153] |
Rabbit polyclonal antibody to Lipoic acid synthetase (lipoic acid synthetase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 54 and 258 of Lipoic acid synthetase (Uniprot ID#O43766) |
Rabbit polyclonal antibody to FAM50A (family with sequence similarity 50, member A)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 149 and 339 of FAM50A (Uniprot ID#Q14320) |
Rabbit polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 533 and 792 of SART1 (Uniprot ID#O43290) |
Rabbit polyclonal antibody to VPAC2 (vasoactive intestinal peptide receptor 2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 334 and 423 of VPAC2 |
Rabbit polyclonal antibody to Axin 1 (axin 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 800 and 862 of AXIN1 (Uniprot ID#O15169) |
Rabbit polyclonal antibody to Thymidylate synthetase (thymidylate synthetase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 313 of Thymidylate synthetase (Uniprot ID#P04818) |
Rabbit polyclonal antibody to C11orf2 (chromosome 11 open reading frame2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 489 and 721 of C11orf2 (Uniprot ID#Q9UID3) |
Rabbit polyclonal anti-MECT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Zebrafish, Pufferfish, Bovine |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 19-34 of human MECT1 protein. |
Active filters
Reactivities
- Zebrafish
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Filter by
Category
Target Symbol
- FAM50A (2)
- H2AFZ (2)
- HPRT1 (2)
- MAT2A (2)
- SMAD2 (2)
- SMAD3 (2)
- TARDBP (2)
- ACAD8 (1)
- AGR2 (1)
- AKT1 (1)
- ALAS2 (1)
- ARAF (1)
- ATG5 (1)
- ATP6V1H (1)
- AXIN1 (1)
- CCT8 (1)
- CKS2 (1)
- CNOT7 (1)
- COMMD3-BMI1 (1)
- CRTC1 (1)
- CRYAA (1)
- CS (1)
- CTNNB1 (1)
- DDX39A (1)
- DLST (1)
- DMC1 (1)
- DMRTA2 (1)
- DOCK1 (1)
- DUSP7 (1)
- ECT2 (1)
- EIF2B2 (1)
- EIPR1 (1)
- EML1 (1)
- EN2 (1)
- FBXO43 (1)
- FOSL2 (1)
- FPGT-TNNI3K (1)
- GALNT7 (1)
- GAPDH (1)
- GET3 (1)
- GIPC1 (1)
- GNAT2 (1)
- GSR (1)
- IDI1 (1)
- IPO7 (1)
- JMJD6 (1)
- KAT2B (1)
- LIAS (1)
- LIMCH1 (1)
- MAPK14 (1)
- MCM7 (1)
- METTL2A (1)
- MIB1 (1)
- NOLC1 (1)
- NSF (1)
- PCCB (1)
- PDE6D (1)
- PGD (1)
- PITX2 (1)
- PSMB8 (1)
- PSMC3 (1)
- PSMC6 (1)
- PTBP1 (1)
- PUF60 (1)
- RAB5A (1)
- RAB5B (1)
- RAB6A (1)
- RAE1 (1)
- RPL13A (1)
- RPLP1 (1)
- SART1 (1)
- SEC13 (1)
- SEC61A1 (1)
- SEC61G (1)
- SERP1 (1)
- SF3B3 (1)
- SNX12 (1)
- ST3GAL2 (1)
- STXBP1 (1)
- SUCLA2 (1)
- TADA3L (1)
- TBCK (1)
- TBP (1)
- TMEM147 (1)
- TPM1 (1)
- TUBA1A (1)
- TUBB (1)
- TYMS (1)
- UAP1 (1)
- UCHL3 (1)
- UCHL5 (1)
- VAPA (1)
- VCP (1)
- VIPR2 (1)
- VPS11 (1)
- VPS26A (1)
- VPS35 (1)
- VPS51 (1)
- XPO7 (1)
- YOD1 (1)
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (50)
- Transcription Factors (16)
- ES Cell Differentiation/IPS (9)
- Transmembrane (8)
- Cancer stem cells (4)
- Embryonic stem cells (4)
- Stem cell - Pluripotency (4)
- Stem cell relevant signaling - JAK/STAT signaling pathway (4)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (4)
- Protease (3)
- Protein Kinase (3)
- GPCR (2)
- Phosphatase (1)
- Secreted Protein (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)
Pathways
- Metabolic pathways (19)
- Colorectal cancer (7)
- Pathways in cancer (7)
- Wnt signaling pathway (6)
- Adherens junction (5)
- Cell cycle (5)
- Pancreatic cancer (5)
- TGF-beta signaling pathway (5)
- Chronic myeloid leukemia (3)
- Citrate cycle (TCA cycle) (3)
- Endometrial cancer (3)
- Pathogenic Escherichia coli infection (3)
- Progesterone-mediated oocyte maturation (3)
- Proteasome (3)
- Purine metabolism (3)
- Spliceosome (3)
- Vibrio cholerae infection (3)
- Amyotrophic lateral sclerosis (ALS) (2)
- Basal cell carcinoma (2)
- Cysteine and methionine metabolism (2)
- Drug metabolism - other enzymes (2)
- Endocytosis (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Focal adhesion (2)
- Gap junction (2)
- Glutathione metabolism (2)
- Leukocyte transendothelial migration (2)
- MAPK signaling pathway (2)
- O-Glycan biosynthesis (2)
- Propanoate metabolism (2)
- Prostate cancer (2)
- RIG-I-like receptor signaling pathway (2)
- Regulation of actin cytoskeleton (2)
- Selenoamino acid metabolism (2)
- Systemic lupus erythematosus (2)
- Tight junction (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Acute myeloid leukemia (1)
- Alzheimer's disease (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Basal transcription factors (1)
- Biosynthesis of unsaturated fatty acids (1)
- Bladder cancer (1)
- Cardiac muscle contraction (1)
- DNA replication (1)
- Dilated cardiomyopathy (1)
- ErbB signaling pathway (1)
- Fc epsilon RI signaling pathway (1)
- Glioma (1)
- Glycine (1)
- Glycolysis / Gluconeogenesis (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glyoxylate and dicarboxylate metabolism (1)
- GnRH signaling pathway (1)
- Huntington's disease (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Insulin signaling pathway (1)
- Keratan sulfate biosynthesis (1)
- Limonene and pinene degradation (1)
- Lipoic acid metabolism (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysine degradation (1)
- Lysosome (1)
- Melanogenesis (1)
- Melanoma (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Neuroactive ligand-receptor interaction (1)
- Neurotrophin signaling pathway (1)
- Non-small cell lung cancer (1)
- Notch signaling pathway (1)
- One carbon pool by folate (1)
- Oocyte meiosis (1)
- Oxidative phosphorylation (1)
- Pentose phosphate pathway (1)
- Porphyrin and chlorophyll metabolism (1)
- Pyrimidine metabolism (1)
- RNA degradation (1)
- Regulation of autophagy (1)
- Renal cell carcinoma (1)
- Ribosome (1)
- T cell receptor signaling pathway (1)
- Terpenoid backbone biosynthesis (1)
- Thyroid cancer (1)
- Toll-like receptor signaling pathway (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- serine and threonine metabolism (1)