Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 360.00
2 Weeks
Rabbit Polyclonal GRAIL/RNF128 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1. |
Rabbit Polyclonal Anti-NUCB2 Antibody
| Applications | IHC, WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
Rabbit Polyclonal Anti-TNFRSF9 Antibody
| Applications | WB |
| Reactivities | Canine, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |
Rabbit Polyclonal Kv1.2 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142] |
Rabbit Polyclonal Kv1.2 Antibody
| Applications | IF |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142] |
Rabbit Polyclonal Anti-TNF-R1 Antibody
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
Rabbit Polyclonal 5-HT7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1). |
USD 424.00
5 Days
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Canine, Feline, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 30-70). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine, Feline, Hamster, Porcin |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Kv1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family. |
Rabbit Polyclonal Potassium Channel Kv3.1 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122] |
Active filters
Category
- Antibodies
Reactivities
- Canine
Antibody Hosts
- Rabbit
Families
- Transmembrane
Filter by
Target Symbol
Isotypes
Clonalities
Conjugates
Pathways
- Apoptosis (4)
- Neuroactive ligand-receptor interaction (4)
- Amyotrophic lateral sclerosis (ALS) (3)
- Chronic myeloid leukemia (2)
- Cytokine-cytokine receptor interaction (2)
- Jak-STAT signaling pathway (2)
- Pancreatic cancer (2)
- Pathways in cancer (2)
- Small cell lung cancer (2)
- Adipocytokine signaling pathway (1)
- Alzheimer's disease (1)
- Axon guidance (1)
- Calcium signaling pathway (1)
- Lysosome (1)
- MAPK signaling pathway (1)