Antibodies

View as table Download

Rabbit anti-ZEB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ZEB1

Rabbit Polyclonal FOXP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3.

Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K).
Modifications Phospho-specific

Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L).
Modifications Phospho-specific

Rabbit anti-RNF2 Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RNF2

Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8
Modifications Phospho-specific

Rabbit Monoclonal Antibody against SOD2 (Clone EPR2560Y)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY

Rabbit polyclonal anti-PGC-1alpha antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha

Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L).
Modifications Phospho-specific

Anti-POU5F1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-150 amino acids of human POU class 5 homeobox 1

Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains.

Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K).
Modifications Phospho-specific

Rabbit polyclonal anti-Cyclin E1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin E1.

Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P).

Rabbit anti-PARP1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PARP1

Rabbit anti-TFAM Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TFAM

Rabbit anti-PPARGC1A polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human PGC-1.

Rabbit Polyclonal VAMP7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VAMP7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human VAMP7.

WT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1

Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P).
Modifications Phospho-specific

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).

Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221
Modifications Phospho-specific

Rabbit Polyclonal HIF1A antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HIF1A

Rabbit Polyclonal Anti-SOX9 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ

Rabbit Polyclonal IRF7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7.

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific

Rabbit polyclonal anti-NR4A3 antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NR4A3.

Rabbit polyclonal PCGF6 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PCGF6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 190-217 amino acids from the Central region of human PCGF6.

Rabbit polyclonal anti-KAP0 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0.

Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780
Modifications Phospho-specific

Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730
Modifications Phospho-specific

Rabbit polyclonal anti-HDAC9 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 25 of human HDAC-9

Anti-HNF4A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC

NFATC2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human NFATC2

Anti-SOX2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human SRY (sex determining region Y)-box 2

Anti-HOXC8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 98-107 amino acids of Human homeobox C8

Anti-SMAD7 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-383 amino acids of Human SMAD family member 7

Anti-RUNX3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 400-415 amino acids of human runt-related transcription factor 3

Anti-FOXO1 (Phospho-Ser256) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 256 (A-A-S(p)-M-D) derived from Human FKHR.
Modifications Phospho-specific

Anti-SPDEF Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 129-332 amino acids of human SAM pointed domain containing ets transcription factor

Rabbit Polyclonal Anti-MYCN Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MYCN

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

Rabbit Polyclonal anti-CUX1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CUX1