Antibodies

View as table Download

Rabbit Polyclonal Anti-CXCL3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL3

Rabbit Polyclonal Anti-CXCL14 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CXCL14

Anti-Human BCA-1 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BCA-1 (CXCL13)

Rabbit Polyclonal Anti-CCL21 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CCL21

Rabbit Polyclonal CCL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human CCL2.

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Rabbit polyclonal anti-CXCL1 (KC) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 78 of mouse KC

Anti-Human GRO-β Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO-β (CXCL2)

Anti-Human IP-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IP-10 (CXCL10)

Rabbit Polyclonal Anti-GRO alpha

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha

Anti-Human BRAK Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BRAK (CXCL14)

Anti-Human GRO/MGSA Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO/MGSA (CXCL1)

Anti-Human MIG Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MIG (CXCL9)

Rabbit anti-CCL5 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CCL5

Rabbit anti-CXCL1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CXCL1

Rabbit Polyclonal Anti-Interleukin 8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 8 Antibody: A synthesized peptide derived from human Interleukin 8

Rabbit Polyclonal Anti-SDF 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1

Rabbit polyclonal anti-Lymphotactin antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen E. coli-expressed mouse lymphotactin (a.a. 1-92)

Rabbit polyclonal CCL2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2.

Anti-Human IL-8 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-8 (72 a.a.) (CXCL8)

Anti-Human I-TAC Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human I-TAC (CXCL11)

Anti-Human MIP-3a Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MIP-3α (CCL20)

Rabbit anti-CCL28 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCL28

Rabbit Polyclonal Anti-CXCL16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16. Synthetic peptide located within the following region: TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV

Rabbit Polyclonal Anti-PF4V1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PF4V1 antibody: synthetic peptide directed towards the middle region of human PF4V1. Synthetic peptide located within the following region: RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE

Rabbit Polyclonal antibody to PF4V1 (platelet factor 4 variant 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 40 and 104 of PF4V1 (Uniprot ID#P10720)

Rabbit Polyclonal CCL4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4.

Rabbit Polyclonal CCL17 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL17 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CCL17.

Rabbit Polyclonal CXCL12 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCL12 antibody was raised against a 16 amino acid peptide near the center of human CXCL12

Biotinylated Anti-Human BCA-1 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BCA-1 (CXCL13)

Anti-Human CXCL16 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human CXCL16

Anti-Human ENA-78 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human ENA-78 (CXCL5) (5-78 a.a.)

Anti-Human Exodus-2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Exodus-2 (CCL21)

Anti-Human GRO-? Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GRO-γ (CXCL3)

Anti-Human MCP-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MCP-1 (CCL2)

Anti-Human MEC Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MEC (CCL28)

Anti-Human PF-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PF-4 (CXCL4)

Anti-Human RANTES Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human RANTES (CCL5)

Rabbit Polyclonal CXCL5 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal CXCL10/INP10 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.

Rabbit Polyclonal Eotaxin Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Eotaxin antibody was raised in rabbits against a peptide corresponding to amino acids near the carboxy terminus of human eotaxin.

Rabbit polyclonal antibody to I-309 (chemokine (C-C motif) ligand 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 32 and 96 of I-309 (Uniprot ID#P22362)

Rabbit polyclonal anti-CX3CL1 (Fractalkine) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human Fractalkine

Rabbit polyclonal anti-CCL2 (MCP-1) antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli-expressed rat MCP-1 (a.a. 1-73)

Rabbit polyclonal anti-SDF-1beta antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli-expressed mouse SDF-1β

Rabbit polyclonal anti-MCP-1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with mature length recombinant human MCP-1 protein produced in E.coli.

Anti-Human GCP-2 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human GCP-2 (CXCL6)

Anti-Human Lymphotactin Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Lymphotactin (XCL1)

Anti-Human MCP-2 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MCP-2 (CCL8)