Rabbit anti-HSPA9 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPA9 |
Rabbit anti-HSPA9 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPA9 |
Rabbit anti-HSPD1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPD1 |
Rabbit Polyclonal Anti-LSM4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LSM4 antibody: synthetic peptide directed towards the middle region of human LSM4. Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK |
Rabbit Polyclonal Anti-EXOSC7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD |
Rabbit Polyclonal Anti-EXOSC7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC |
Rabbit Polyclonal Anti-EXOSC3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES |
Rabbit Polyclonal Anti-EXOSC3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the middle region of human EXOSC3. Synthetic peptide located within the following region: TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK |
Rabbit polyclonal anti-HSP60 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human HSP60. |
Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1. |
Rabbit anti-LSM4 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LSM4 |
Rabbit Polyclonal Anti-LSM6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the N terminal of human LSM6. Synthetic peptide located within the following region: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE |
Grp75 (HSPA9) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to C-Terminus of Human GRP75. |
Hsp60 (HSPD1) rabbit polyclonal antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Hsp60 (HSPD1) rabbit polyclonal antibody
Applications | FC, IF, IHC, WB |
Reactivities | Mouse, Primate, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-LSM6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the middle region of human LSM6. Synthetic peptide located within the following region: YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR |
Rabbit Polyclonal Anti-LSM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LSM1 antibody: synthetic peptide directed towards the middle region of human LSM1. Synthetic peptide located within the following region: SDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDE |
Rabbit Polyclonal Anti-EXOSC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EXOSC3 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOSC3. Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK |
Rabbit Polyclonal Anti-EXOSC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL |
Rabbit Polyclonal Anti-GRP75 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRP75 Antibody: A synthesized peptide derived from human GRP75 |
Rabbit Polyclonal Anti-HSP60 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSP60 Antibody: A synthesized peptide derived from human HSP60 |
Rabbit Polyclonal Anti-GRP75 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRP75 Antibody: A synthesized peptide derived from human GRP75 |
Hsp60 (HSPD1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide mapping at the middle region of human HSP60 |
Rabbit Polyclonal Exosome Component 9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human EXOSC9 protein (within residues 250-439). [Swiss-Prot Q06265] |
Rabbit polyclonal HSPD1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit Polyclonal anti-HSPA9 antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
Grp75 (HSPA9) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 280-309 amino acids from the Central region of human Grp75 / HSPA9 |
LSM7 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 52-80 amino acids from the C-terminal region of human LSM7 |
Anti-HSPA9 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 70kDa protein 9 (mortalin) |
Rabbit polyclonal Hsp60 Antibody
Applications | WB |
Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Human Hsp60 produced through recombinant DNA methods in E.coli |
Rabbit Polyclonal Anti-LSM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LSM5 Antibody is: synthetic peptide directed towards the middle region of Human LSM5. Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Rabbit Polyclonal Anti-HSPA9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSPA9 |
EXOSC9 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |