Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Androgen Receptor (Ab-650) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 650 (T-T-SP-P-T). |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit anti-PPP2R1A Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP2R1A |
Rabbit polyclonal Cyclin E1 (Thr395) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ |
Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
Rabbit Polyclonal Anti-PTTG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTTG1 Antibody: A synthesized peptide derived from human PTTG1 |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401) |
Rabbit polyclonal Androgen Receptor (Ab-213) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 213 (E-A-SP-G-A). |
Rabbit Polyclonal Cyclin E1 (Thr395) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin E1 around the phosphorylation site of Threonine 395 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Cyclin E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin E1 |
Rabbit Polyclonal Progesterone Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor |
Rabbit Polyclonal Progesterone Receptor (Ser294) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 294 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Progesterone Receptor (Ser400) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 400 |
| Modifications | Phospho-specific |
Rabbit polyclonal Androgen Receptor (Phospho-Tyr363) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Androgen Receptor around the phosphorylation site of tyrosine 363 (D-Y-YP-N-F). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Androgen Receptor (Ser650) Antibody (Phospho-specific)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Androgen Receptor around the phosphorylation site of Serine 650 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Progesterone Receptor Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor |
Rabbit polyclonal anti-Calcineurin A antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A |
Rabbit polyclonal PGR/PR Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PGR/PR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 816-843 amino acids from the C-terminal region of human PGR/PR. |
Rabbit Polyclonal Androgen Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Androgen Receptor |
Rabbit Polyclonal Cyclin E1 (Thr395) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Cyclin E1 around the phosphorylation site of Threonine 395. |
| Modifications | Phospho-specific |
Rabbit polyclonal Androgen Receptor (Ab-363) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of tyrosine 363 (D-Y-YP-N-F). |
Rabbit Polyclonal Anti-YWHAH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YWHAH antibody: synthetic peptide directed towards the N terminal of human YWHAH. Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV |
Rabbit anti Progesterone Receptor (PR) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-terminus of human Progesterone receptor. This sequence is identical within human, mouse, rat, chicken, bovine and dog origins. |
Rabbit anti Androgen Receptor (AR) (pS210) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope –EASGA- with a single phosphorylation site Ser210. This sequence is identical among human, rat, mouse, dog. |
Rabbit anti Androgen Receptor (AR) (Paired S210) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope –EASGA- without phosphorylation. This sequence is identical among human, rat, mouse, dog. |
Rabbit polyclonal Androgen Receptor (Ser94) antibody(Phospho-specific)
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 94 (D-G-SP-P-Q). |
| Modifications | Phospho-specific |
Anti-CCNE1 (phospho-Thr395) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 395 (L-L-T(p)-P-P)derived from Human Cyclin E1 |
| Modifications | Phospho-specific |
Phospho-CCNE1-T395 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T395 of human CCNE1 |
| Modifications | Phospho-specific |
Phospho-AR-S650 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S650 of human AR |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PPP2CA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI |
Rabbit Polyclonal Cyclin E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Partial residue sequence of Cyclin E1. |
Rabbit anti Cyclin E Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human Cyclin E protein. The sequence is identical to human, mouse. |
Anti-CCNE1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 398-410 amino acids of Human Cyclin E1 |
Anti-PTTG1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 99-112 amino acids of human pituitary tumor-transforming 1 |
Rabbit Polyclonal Anti-PPP2CA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PPP2CA |
Rabbit Polyclonal Anti-AR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AR |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Families
- Transcription Factors
Pathways
- Oocyte meiosis