CA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CA3 |
CA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CA3 |
Rabbit anti-GLUL Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GLUL |
Rabbit anti-ASNS Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ASNS |
Rabbit anti-CA1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CA1 |
Rabbit Monoclonal antibody against CPS1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal GLS2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GLS2 antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2. |
Rabbit polyclonal GLS Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS. |
CA2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CA2 |
Rabbit polyclonal anti-CA3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA3. |
Rabbit polyclonal anti-CA5B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA5B. |
Rabbit polyclonal anti-CA14 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA14. |
Rabbit polyclonal anti-CA13 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA13. |
Anti-CA14 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV |
Rabbit polyclonal CA2 Antibody (N-term)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CA2. |
Glutamine Synthetase (GLUL) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-GLUL Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.365~369(G-D-E-P-F) derived from Human Glutamine Synthetase |
Rabbit polyclonal CA3 Antibody (Center)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CA3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 146-177 amino acids from the Central region of human CA3. |
Rabbit Polyclonal Antibody against Glutamine Synthase
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein. |
Rabbit Polyclonal Anti-ASNS Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR |
Anti-CA14 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV |
Anti-CA3 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3 |
Anti-CA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3 |
Anti-CA4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4 |
Anti-CA4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4 |
Anti-CA2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-CA2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-CA1 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-CA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-ASNS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ASNS |
Rabbit Polyclonal Anti-GLUL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GLUL |
Rabbit Polyclonal Anti-GLS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GLS |