Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ACAT1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACAT1 |
Rabbit Polyclonal Anti-TDO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TDO2 antibody: synthetic peptide directed towards the N terminal of human TDO2. Synthetic peptide located within the following region: LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV |
Rabbit anti-MAOA Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOA |
Rabbit Polyclonal Anti-CYP1B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Cyp1b1 antibody is: synthetic peptide directed towards the middle region of human CYP1B1 |
Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit anti-HADH Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HADH |
Rabbit Polyclonal Anti-DDC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE |
Rabbit polyclonal KMO Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This KMO antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 155-182 amino acids from the Central region of human KMO. |
Rabbit anti-HADHA Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HADHA |
Rabbit Polyclonal Anti-AADAT Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the N terminal of human AADAT. Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI |
Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit Polyclonal Anti-ABP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801) |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
Applications | WB |
Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit anti-AADAT polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human AADAT. |
Rabbit polyclonal TPH2 (Ab-19) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19 (G-FI-SP-L-D). |
Rabbit polyclonal CYP1A2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit anti-CYP1A1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP1A1 |
Rabbit anti-WARS Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human WARS |
Rabbit Polyclonal HAAO Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HAAO antibody was raised against a 17 amino acid peptide near the amino terminus of human HAAO. |
Rabbit polyclonal anti-AOX1 antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AOX1. |
Rabbit polyclonal anti-EHHADH antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EHHADH. |
Rabbit Polyclonal Anti-ACAT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR |
Rabbit Polyclonal Anti-OGDH Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OGDH antibody: synthetic peptide directed towards the N terminal of human OGDH. Synthetic peptide located within the following region: MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL |
Rabbit Polyclonal Anti-WARS Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WARS antibody: synthetic peptide directed towards the N terminal of human WARS. Synthetic peptide located within the following region: EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF |
Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS |
Rabbit Polyclonal Anti-OGDHL Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OGDHL antibody: synthetic peptide directed towards the N terminal of human OGDHL. Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR |
Rabbit Polyclonal Anti-ASMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ASMT antibody is: synthetic peptide directed towards the N-terminal region of Human ASMT. Synthetic peptide located within the following region: GSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAA |
Rabbit Polyclonal Anti-DDC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the middle region of human DDC. Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL |
Rabbit Polyclonal Anti-HAAO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HAAO antibody: synthetic peptide directed towards the N terminal of human HAAO. Synthetic peptide located within the following region: HRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVG |
Rabbit Polyclonal Anti-INMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-INMT antibody: synthetic peptide directed towards the N terminal of human INMT. Synthetic peptide located within the following region: KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP |
Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2 |
Rabbit Polyclonal CYP1B1 Antibody
Applications | ELISA, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
ACAT1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
ACAT1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide from Human ACAT1. Epitope: Internal. |
Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719) |
Rabbit polyclonal Cytochrome P450 1A1/2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A1/2. |
Rabbit polyclonal Cytochrome P450 1A2 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2. |
Rabbit polyclonal anti-ALDH1B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ALDH1B1. |
Rabbit polyclonal anti-CP1B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CP1B1. |
Rabbit polyclonal TPH2(Ser19) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human: Ser19, Mouse: Ser19, Rat: Ser19 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-IL4I1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1. |
KATII / AADAT Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Immunogen | KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from N-terminus of human AADAT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Elephant (100%); Monkey, Rabbit (94%); Marmoset, Dog (82%). |
KATII / AADAT Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Gorilla, Gibbon |
Immunogen | KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from internal region of human AADAT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey (88%); Dog, Elephant (82%). |
Rabbit polyclonal HADHA Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HADHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 737-763 amino acids from the C-terminal region of human HADHA. |