Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal Anti-GRSF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the middle region of human GRSF1. Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Active filters
Reactivities
- Human
Antibody Hosts
- Rabbit
Filter by
Target Symbol
- EGFR (85)
- MAPT (78)
- AKT1 (66)
- H3C1 (65)
- TP53 (59)
- RELA (53)
- JUN (41)
- AMH (37)
- ERBB2 (35)
- IRS1 (35)
- STAT3 (35)
- MAPK14 (34)
- APP (33)
- NFKBIA (33)
- CASP3 (32)
- ESR1 (32)
- NPPB (32)
- SMAD3 (32)
- MAP2K1 (31)
- BCL2 (30)
- CTNNB1 (30)
- GSK3B (30)
- SMAD2 (30)
- CREB1 (29)
- HIF1A (29)
- HSPB1 (29)
- POMC (29)
- RB1 (29)
- YAP1 (29)
- ATF2 (28)
- JAK2 (28)
- KDR (28)
- CHUK (27)
- GCG (27)
- PRKAA1 (27)
- PRKCD (27)
- BRAF (26)
- BRCA1 (26)
- CHEK1 (26)
- FOXO1 (26)
- NFKB1 (26)
- RAF1 (26)
- RPS6KB1 (26)
- STAT1 (26)
- CD44 (25)
- EZR (25)
- IGF1R (25)
- MAPK1 (25)
- NR3C1 (25)
- SMAD1 (25)
- BAX (24)
- CDK1 (24)
- CDKN2A (24)
- EIF4EBP1 (24)
- H3-4 (24)
- HISTONE H3 (24)
- MYC (24)
- NPPA (24)
- PRKCA (24)
- PTEN (24)
- MAP3K5 (23)
- PTK2 (23)
- BAD (22)
- CCNB1 (22)
- CDC25A (22)
- MAPK8 (22)
- RPS6KA1 (22)
- VIM (22)
- CASP9 (21)
- CHEK2 (21)
- CSF1R (21)
- HIST1H3A (21)
- IKBKG (21)
- MET (21)
- NOS3 (21)
- SNCA (21)
- CDH1 (20)
- HDAC2 (20)
- MAP3K7 (20)
- MTOR (20)
- PDGFRB (20)
- PDYN (20)
- PIK3R1 (20)
- RUNX1 (20)
- SRC (20)
- TGFB1 (20)
- TSC2 (20)
- XRCC6 (20)
- EDN1 (19)
- FOS (19)
- GSK3A (19)
- HDAC5 (19)
- SOX2 (19)
- STAT6 (19)
- VEGFA (19)
- AR (18)
- BCL2L1 (18)
- CCNE1 (18)
- ELK1 (18)
- HSP90AB1 (18)
Applications
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (8100)
- Phospho-specific (1390)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (80)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (26)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (20)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (19)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. (17)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (13)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (7)
- Phospho S83 (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (6)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (6)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (5)
- Acetyl K5 (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (4)
- Phospho S15 (3)
- Phospho S166 (3)
- Phospho S376 (3)
- Phospho T286 (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgM format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- Acetyl K16 (2)
- Acetyl K27 (2)
- Acetyl K36 (2)
- Acetyl K4 (2)
- MonoMethyl K342 (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- Phospho S104 (2)
- Phospho S127 (2)
- Phospho S128 (2)
- Phospho S129 (2)
- Phospho S139 (2)
- Phospho S16 (2)
- Phospho S176/180 (2)
- Phospho S21 (2)
- Phospho S319 (2)
- Phospho S345 (2)
- Phospho S366 (2)
- Phospho S37 (2)
- Phospho S380 (2)
- Phospho S39 (2)
- Phospho S396 (2)
- Phospho S56 (2)
- Phospho S616 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- Phospho S89 (2)
- Phospho S9 (2)
- Phospho T183/T172 (2)
- Phospho T187 (2)
- Phospho T389 (2)
- Phospho T514 (2)
- Phospho Y410 (2)
- Phospho Y779 (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K262/K265/K274 (1)
- Acetyl K29 (1)
- Acetyl K332 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho 180/Y182,Phospho T180/Y182,Phospho T180/Y182,Phospho T183/Y1845 (1)
- Phospho Phospho S87 (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S102 (1)
- Phospho S1033 (1)
- Phospho S11 (1)
- Phospho S1105 (1)
- Phospho S1108 (1)
- Phospho S112 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S1387 (1)
- Phospho S1490 (1)
- Phospho S157 (1)
- Phospho S16/T17 (1)
- Phospho S17 (1)
- Phospho S172 (1)
- Phospho S176 (1)
- Phospho S180 (1)
- Phospho S182 (1)
- Phospho S189,Phospho S207 (1)
- Phospho S19 (1)
- Phospho S194 (1)
- Phospho S1943 (1)
- Phospho S1981 (1)
- Phospho S199/S204 (1)
- Phospho S2 (1)
- Phospho S20 (1)
- Phospho S202 (1)
- Phospho S2056 (1)
- Phospho S209 (1)
- Phospho S211 (1)
- Phospho S2152 (1)
- Phospho S217 (1)
- Phospho S22 (1)
- Phospho S235/236 (1)
- Phospho S240/244 (1)
- Phospho S241 (1)
- Phospho S243 (1)
- Phospho S2448 (1)
- Phospho S2481 (1)
- Phospho S253 (1)
- Phospho S257 (1)
- Phospho S257/T261 (1)
- Phospho S259 (1)
- Phospho S271 (1)
- Phospho S271/T275 (1)
- Phospho S28 (1)
- Phospho S280 (1)
- Phospho S29/33/37/T41 (1)
- Phospho S293 (1)
- Phospho S294 (1)
- Phospho S296 (1)
- Phospho S298 (1)
- Phospho S299 (1)
- Phospho S304 (1)
- Phospho S307 (1)
- Phospho S308,Phospho S309,Phospho S305 (1)
- Phospho S32 (1)
- Phospho S32/S36 (1)
- Phospho S320 (1)
- Phospho S323 (1)
- Phospho S326 (1)
- Phospho S33 (1)
- Phospho S33/35 (1)
- Phospho S33/S37/T41 (1)
- Phospho S330 (1)
- Phospho S334 (1)
- Phospho S338 (1)
- Phospho S36 (1)
- Phospho S365 (1)
- Phospho S380/T382/383 (1)
- Phospho S386 (1)
- Phospho S392 (1)
- Phospho S397 (1)
- Phospho S4/S8 (1)
- Phospho S409/S410 (1)
- Phospho S412 (1)
- Phospho S420 (1)
- Phospho S422 (1)
- Phospho S423/S425 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S445 (1)
- Phospho S448 (1)
- Phospho S45 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S465/S467 (1)
- Phospho S467 (1)
- Phospho S471/472 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S474 (1)
- Phospho S483 (1)
- Phospho S485 (1)
- Phospho S5 (1)
- Phospho S505 (1)
- Phospho S507 (1)
- Phospho S51 (1)
- Phospho S516 (1)
- Phospho S519/T522 (1)
- Phospho S529 (1)
- Phospho S552 (1)
- Phospho S555 (1)
- Phospho S563 (1)
- Phospho S588 (1)
- Phospho S6 (1)
- Phospho S608 (1)
- Phospho S611/615 (1)
- Phospho S611/615/616 (1)
- Phospho S612 (1)
- Phospho S615 (1)
- Phospho S62 (1)
- Phospho S621 (1)
- Phospho S63 (1)
- Phospho S636/639 (1)
- Phospho S637 (1)
- Phospho S638 (1)
- Phospho S641 (1)
- Phospho S643/676 (1)
- Phospho S645 (1)
- Phospho S65 (1)
- Phospho S657/Y658 (1)
- Phospho S660 (1)
- Phospho S668 (1)
- Phospho S675 (1)
- Phospho S7 (1)
- Phospho S70 (1)
- Phospho S71 (1)
- Phospho S728 (1)
- Phospho S73 (1)
- Phospho S744/748 (1)
- Phospho S757 (1)
- Phospho S80 (1)
- Phospho S807/811 (1)
- Phospho S811 (1)
- Phospho S82 (1)
- Phospho S838/S840 (1)
- Phospho S845 (1)
- Phospho S886 (1)
- Phospho S890 (1)
- Phospho S896/S897 (1)
- Phospho S897 (1)
- Phospho S916 (1)
- Phospho S932 (1)
- Phospho S957 (1)
- Phospho S967 (1)
- Phospho Ser15 (1)
- Phospho Ser198/Ser199/Ser202 (1)
- Phospho Ser355 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho Ser551 (1)
- Phospho Ser729 (1)
- Phospho Ser792 (1)
- Phospho Ser90 (1)
- Phospho T11 (1)
- Phospho T117 (1)
- Phospho T14 (1)
- Phospho T1462 (1)
- Phospho T156 (1)
- Phospho T163 (1)
- Phospho T17 (1)
- Phospho T172 (1)
- Phospho T179 (1)
- Phospho T18 (1)
- Phospho T18/S19 (1)
- Phospho T180/T183 (1)
- Phospho T180/Y182 (1)
- Phospho T180/Y182 + T183/Y1845 (1)
- Phospho T181 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T184/T187 (1)
- Phospho T186 (1)
- Phospho T189 (1)
- Phospho T197 (1)
- Phospho T197/202 (1)
- Phospho T1989 (1)
- Phospho T199 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T202/Y204+T185/Y187 (1)
- Phospho T204 (1)
- Phospho T210 (1)
- Phospho T212 (1)
- Phospho T217 (1)
- Phospho T23 (1)
- Phospho T231/S232 (1)
- Phospho T232 (1)
- Phospho T235 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T246 (1)
- Phospho T261 (1)
- Phospho T288 (1)
- Phospho T288,Phospho T232,Phospho T198 (1)
- Phospho T292 (1)
- Phospho T3 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T334 (1)
- Phospho T346 (1)
- Phospho T357/S358/S360 (1)
- Phospho T359 (1)
- Phospho T359/S363 (1)
- Phospho T37/46 (1)
- Phospho T384 (1)
- Phospho T387 (1)
- Phospho T395 (1)
- Phospho T410 (1)
- Phospho T421/S424 (1)
- Phospho T434 (1)
- Phospho T446 (1)
- Phospho T45 (1)
- Phospho T495 (1)
- Phospho T498 (1)
- Phospho T505 (1)
- Phospho T508/T505 (1)
- Phospho T538 (1)
- Phospho T543 (1)
- Phospho T56 (1)
- Phospho T567,Phospho T564,Phospho T558 (1)
- Phospho T573 (1)
- Phospho T58 (1)
- Phospho T581 (1)
- Phospho T6 (1)
- Phospho T641 (1)
- Phospho T642 (1)
- Phospho T669 (1)
- Phospho T678 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T696 (1)
- Phospho T70 (1)
- Phospho T81 (1)
- Phospho T845 (1)
- Phospho T853 (1)
- Phospho T91 (1)
- Phospho T918 (1)
- Phospho T93 (1)
- Phospho T982 (1)
- Phospho Thr212/Ser214 (1)
- Phospho Thr421 (1)
- Phospho Y10 (1)
- Phospho Y1007 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1008 (1)
- Phospho Y1018 (1)
- Phospho Y1020 (1)
- Phospho Y1021 (1)
- Phospho Y1022/1023 (1)
- Phospho Y1045 (1)
- Phospho Y1054/1055 (1)
- Phospho Y1068 (1)
- Phospho Y1070 (1)
- Phospho Y1086 (1)
- Phospho Y1096 (1)
- Phospho Y1148 (1)
- Phospho Y1165/1166,Phospho Y1189/1190 (1)
- Phospho Y1173 (1)
- Phospho Y1175 (1)
- Phospho Y1189/Y1190,Phospho Y1165/Y1166 (1)
- Phospho Y1217 (1)
- Phospho Y1221/1222 (1)
- Phospho Y1234/1235 (1)
- Phospho Y1248 (1)
- Phospho Y1284 (1)
- Phospho Y133 (1)
- Phospho Y1349 (1)
- Phospho Y1361 (1)
- Phospho Y138 (1)
- Phospho Y139 (1)
- Phospho Y14 (1)
- Phospho Y145 (1)
- Phospho Y1474 (1)
- Phospho Y15 (1)
- Phospho Y165 (1)
- Phospho Y171 (1)
- Phospho Y177 (1)
- Phospho Y182 (1)
- Phospho Y191 (1)
- Phospho Y204 (1)
- Phospho Y207 (1)
- Phospho Y216 (1)
- Phospho Y221 (1)
- Phospho Y232 (1)
- Phospho Y245 (1)
- Phospho Y284 (1)
- Phospho Y291 (1)
- Phospho Y292 (1)
- Phospho Y307 (1)
- Phospho Y311 (1)
- Phospho Y317 (1)
- Phospho Y322 (1)
- Phospho Y323 (1)
- Phospho Y340 (1)
- Phospho Y353 (1)
- Phospho Y397 (1)
- Phospho Y402 (1)
- Phospho Y412 (1)
- Phospho Y416 (1)
- Phospho Y416/Y416 (1)
- Phospho Y467/Y199/Y464 (1)
- Phospho Y564 (1)
- Phospho Y576/577 (1)
- Phospho Y589/591 (1)
- Phospho Y594 (1)
- Phospho Y653 (1)
- Phospho Y659 (1)
- Phospho Y674/675 + Y706/707 (1)
- Phospho Y694 (1)
- Phospho Y699 (1)
- Phospho Y700 (1)
- Phospho Y705 (1)
- Phospho Y708 (1)
- Phospho Y719 (1)
- Phospho Y723 (1)
- Phospho Y724 (1)
- Phospho Y731 (1)
- Phospho Y751 (1)
- Phospho Y754 (1)
- Phospho Y759 (1)
- Phospho Y771 (1)
- Phospho Y789 (1)
- Phospho Y792 (1)
- Phospho Y845 (1)
- Phospho Y849 (1)
- Phospho Y869 (1)
- Phospho Y925 (1)
- Phospho Y980/981 (1)
- Phospho Y992 (1)
- Phospho Y996 (1)
- Phospho Y998 (1)
- Phospho pS221 (1)
- Phospho s724 (1)
- Phospho-PKC (pan) (βII Ser660) (1)
- Phospho-RPS6KB1-S371 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Chicken scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- Ubiquityl K119 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
- monoMethyl E105 (1)
- pan Phospho-Serine/Threonine (1)
- pan Symmetric-DiMethyl-Arginine (1)
- phospho S76 (1)
- phospho T1079,Phospho T1041 (1)
- succinylation K79 (1)
Assay Types
Assay Platforms
Families
- Druggable Genome (18891)
- Transmembrane (8701)
- Transcription Factors (5606)
- Secreted Protein (2859)
- Protein Kinase (2200)
- ES Cell Differentiation/IPS (1799)
- Stem cell - Pluripotency (1243)
- GPCR (1072)
- Protease (1054)
- Adult stem cells (410)
- Embryonic stem cells (351)
- Phosphatase (331)
- Nuclear Hormone Receptor (317)
- Cancer stem cells (283)
- Ion Channels: Other (254)
- Stem cell relevant signaling - JAK/STAT signaling pathway (233)
- Induced pluripotent stem cells (215)
- Ion Channels: Potassium (152)
- P450 (149)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (123)
- Stem cell relevant signaling - DSL/Notch pathway (117)
- Ion Channels: Cys-loop Receptors (104)
- Stem cell relevant signaling - Wnt Signaling pathway (99)
- Ion Channels: Transient receptor potential (86)
- Ion Channels: Glutamate Receptors (69)
- Ion Channels: Sodium (33)
- Ion Channels: ATP Receptors (22)
- Ion Channels: Cyclic nucleotide gated (16)
- Ion Channels: Calcium (12)
Pathways
- Metabolic pathways (2265)
- Pathways in cancer (2259)
- MAPK signaling pathway (1459)
- Focal adhesion (1122)
- Cytokine-cytokine receptor interaction (1090)
- Neuroactive ligand-receptor interaction (977)
- Chemokine signaling pathway (963)
- Neurotrophin signaling pathway (937)
- Prostate cancer (905)
- Regulation of actin cytoskeleton (860)
- Cell cycle (768)
- Chronic myeloid leukemia (751)
- Colorectal cancer (751)
- Pancreatic cancer (741)
- Insulin signaling pathway (727)
- ErbB signaling pathway (719)
- T cell receptor signaling pathway (717)
- Jak-STAT signaling pathway (714)
- Wnt signaling pathway (690)
- Calcium signaling pathway (687)
- Apoptosis (676)
- Endocytosis (671)
- Small cell lung cancer (670)
- Toll-like receptor signaling pathway (666)
- Alzheimer's disease (624)
- Leukocyte transendothelial migration (602)
- Acute myeloid leukemia (580)
- Melanoma (574)
- Progesterone-mediated oocyte maturation (562)
- Huntington's disease (552)
- Glioma (550)
- Natural killer cell mediated cytotoxicity (548)
- B cell receptor signaling pathway (545)
- Adipocytokine signaling pathway (533)
- Endometrial cancer (522)
- Non-small cell lung cancer (518)
- Tight junction (502)
- Adherens junction (498)
- Fc gamma R-mediated phagocytosis (493)
- p53 signaling pathway (481)
- Melanogenesis (477)
- Renal cell carcinoma (477)
- Oocyte meiosis (475)
- Axon guidance (473)
- VEGF signaling pathway (469)
- GnRH signaling pathway (468)
- TGF-beta signaling pathway (453)
- Epithelial cell signaling in Helicobacter pylori infection (450)
- Ubiquitin mediated proteolysis (440)
- Fc epsilon RI signaling pathway (436)
- Olfactory transduction (430)
- Gap junction (425)
- NOD-like receptor signaling pathway (423)
- Bladder cancer (410)
- Vascular smooth muscle contraction (409)
- Amyotrophic lateral sclerosis (ALS) (391)
- Cell adhesion molecules (CAMs) (391)
- RIG-I-like receptor signaling pathway (389)
- mTOR signaling pathway (369)
- Hematopoietic cell lineage (348)
- Parkinson's disease (343)
- Long-term potentiation (329)
- Systemic lupus erythematosus (324)
- Purine metabolism (315)
- Long-term depression (308)
- Pathogenic Escherichia coli infection (306)
- Dilated cardiomyopathy (295)
- Hypertrophic cardiomyopathy (HCM) (281)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (274)
- Cytosolic DNA-sensing pathway (274)
- Basal cell carcinoma (267)
- Type II diabetes mellitus (263)
- Spliceosome (255)
- PPAR signaling pathway (248)
- Viral myocarditis (246)
- Antigen processing and presentation (241)
- ECM-receptor interaction (241)
- Thyroid cancer (238)
- Lysosome (226)
- Complement and coagulation cascades (219)
- Glycolysis / Gluconeogenesis (219)
- Prion diseases (191)
- Notch signaling pathway (188)
- Hedgehog signaling pathway (186)
- Oxidative phosphorylation (184)
- Pyrimidine metabolism (183)
- Phosphatidylinositol signaling system (177)
- Vibrio cholerae infection (175)
- Ribosome (172)
- Drug metabolism - cytochrome P450 (169)
- Metabolism of xenobiotics by cytochrome P450 (167)
- Arginine and proline metabolism (163)
- Primary immunodeficiency (163)
- Dorso-ventral axis formation (160)
- Nucleotide excision repair (150)
- Cardiac muscle contraction (144)
- Retinol metabolism (133)
- Arachidonic acid metabolism (132)
- Type I diabetes mellitus (131)
- Valine (131)
- RNA degradation (127)
- Tyrosine metabolism (127)
- Base excision repair (122)
- Proteasome (122)
- Inositol phosphate metabolism (119)
- Pyruvate metabolism (117)
- Fatty acid metabolism (114)
- Glycerolipid metabolism (114)
- Regulation of autophagy (114)
- Autoimmune thyroid disease (113)
- Glycerophospholipid metabolism (113)
- Homologous recombination (113)
- leucine and isoleucine degradation (113)
- DNA replication (111)
- Graft-versus-host disease (111)
- Tryptophan metabolism (111)
- Allograft rejection (110)
- ABC transporters (106)
- Alanine (106)
- aspartate and glutamate metabolism (106)
- Drug metabolism - other enzymes (103)
- Fructose and mannose metabolism (99)
- Maturity onset diabetes of the young (97)
- Glutathione metabolism (96)
- Starch and sucrose metabolism (96)
- Amino sugar and nucleotide sugar metabolism (95)
- Basal transcription factors (95)
- Butanoate metabolism (95)
- Cysteine and methionine metabolism (95)
- Lysine degradation (93)
- Taste transduction (93)
- Citrate cycle (TCA cycle) (86)
- Mismatch repair (84)
- Sphingolipid metabolism (83)
- Androgen and estrogen metabolism (79)
- Asthma (79)
- Porphyrin and chlorophyll metabolism (79)
- Histidine metabolism (75)
- Propanoate metabolism (74)
- Galactose metabolism (71)
- Glycine (71)
- serine and threonine metabolism (71)
- Non-homologous end-joining (69)
- Nitrogen metabolism (65)
- Pentose phosphate pathway (62)
- Renin-angiotensin system (61)
- SNARE interactions in vesicular transport (61)
- Aminoacyl-tRNA biosynthesis (59)
- Phenylalanine metabolism (58)
- beta-Alanine metabolism (58)
- N-Glycan biosynthesis (56)
- Ether lipid metabolism (55)
- Linoleic acid metabolism (54)
- Nicotinate and nicotinamide metabolism (53)
- Selenoamino acid metabolism (46)
- Biosynthesis of unsaturated fatty acids (45)
- RNA polymerase (45)
- Pentose and glucuronate interconversions (41)
- Primary bile acid biosynthesis (41)
- Ascorbate and aldarate metabolism (40)
- Riboflavin metabolism (40)
- Limonene and pinene degradation (38)
- Glycosaminoglycan degradation (37)
- Terpenoid backbone biosynthesis (36)
- Circadian rhythm - mammal (32)
- Folate biosynthesis (32)
- C21-Steroid hormone metabolism (31)
- O-Glycan biosynthesis (31)
- One carbon pool by folate (31)
- Glyoxylate and dicarboxylate metabolism (30)
- Heparan sulfate biosynthesis (30)
- Glycosphingolipid biosynthesis - lacto and neolacto series (29)
- Chondroitin sulfate biosynthesis (28)
- Pantothenate and CoA biosynthesis (28)
- Taurine and hypotaurine metabolism (28)
- Keratan sulfate biosynthesis (25)
- Other glycan degradation (25)
- Glycosphingolipid biosynthesis - ganglio series (23)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (23)
- Steroid biosynthesis (23)
- alpha-Linolenic acid metabolism (23)
- leucine and isoleucine biosynthesis (23)
- Caffeine metabolism (21)
- Synthesis and degradation of ketone bodies (21)
- Fatty acid elongation in mitochondria (18)
- Methane metabolism (18)
- Glycosphingolipid biosynthesis - globo series (16)
- Sulfur metabolism (16)
- Fatty acid biosynthesis (15)
- Phenylalanine (14)
- tyrosine and tryptophan biosynthesis (14)
- Cyanoamino acid metabolism (13)
- Protein export (13)
- Vitamin B6 metabolism (12)
- D-Glutamine and D-glutamate metabolism (11)
- Thiamine metabolism (11)
- Lysine biosynthesis (10)
- Ubiquinone and other terpenoid-quinone biosynthesis (7)
- Lipoic acid metabolism (6)
- O-Mannosyl glycan biosynthesis (4)
- D-Arginine and D-ornithine metabolism (1)