Antibodies

View as table Download

Rabbit Polyclonal PAK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PAK2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human PAK2.

Rabbit Polyclonal CXCR4 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4.

Rabbit Polyclonal antibody to Calcium binding protein P22

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 47 and 141 of Calcium binding protein P22 (Uniprot ID#Q99653)

Rabbit polyclonal anti-EPHB6 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHB6.

Rabbit Polyclonal ROCK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK2 antibody was raised against a 15 amino acid synthetic peptide near the center of human ROCK2.

Rabbit polyclonal NRAS Antibody (N-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS.

Mouse Monoclonal GSK-3 beta Antibody (3D10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated

Rabbit Polyclonal LIM kinase 2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Goat Anti-UNC5C Antibody

Applications IF
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence NCTVSEEPTGID, from the internal region of the protein sequence according to NP_003719.2.

Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1

Rabbit polyclonal anti-EFNA5 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EFNA5.

Rabbit polyclonal anti-LIMK2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LIMK2.

Rabbit polyclonal c-Met (Ab-1003) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A).
Modifications Phospho-specific

Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Tyr1003, Mouse: Tyr1001, Rat: Tyr1004
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A).
Modifications Phospho-specific

Rabbit polyclonal anti-EFNA1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EFNA1.

Rabbit polyclonal DRP-2 (Ab-514) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human DRP-2 around the phosphorylation site of threonine 514 (T-V-TP-P-A).

Rabbit polyclonal EPHA2/3/4 (Ab-588/596) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EPHA2/3/4 around the phosphorylation site of tyrosine 588/596 (T-YP-V-D-P).

Rabbit polyclonal EPHA2/3/4 (Tyr588/596) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EPHA2/3/4 around the phosphorylation site of tyrosine 588/596 (T-YP-V-D-P).
Modifications Phospho-specific

Rabbit polyclonal anti-EPHA1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA1.

Rabbit polyclonal anti-EPHB1/2/3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHB1/2/3.

Mouse monoclonal MET/HGFR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal EFNB2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EFNB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 157-186 amino acids from the Central region of human EFNB2.

Rabbit Polyclonal Anti-EphA1 (extracellular)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KKEPRQLELTWAGSR, corresponding to amino acid residues 457-471 of human EphA1. Extracellular, N-terminus.

Rabbit Polyclonal CXCR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human CXCR4 protein (within residues 300-352). [Swiss-Prot P61073]

Rabbit Polyclonal CXCR4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4.

Rabbit Polyclonal PAK4 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen PAK4 antibody was raised against a 13 amino acid peptide from near the center of human PAK4.

Rabbit Polyclonal PAK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PAK2 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human PAK2.

Rabbit Polyclonal CXCR4-Lo Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CXCR4-Lo antibody was raised against a peptide corresponding to nine amino acids near the amino terminus of human CXCR4 isoform a.

Rabbit polyclonal antibody to Cofilin 2 (cofilin 2 (muscle))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 92 and 166 of Cofilin 2

Rabbit polyclonal antibody to H-Ras (v-Ha-ras Harvey rat sarcoma viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 111 and 189 of H-Ras (Uniprot ID#P01112)

Rabbit Polyclonal antibody to Cofilin 2 (muscle) (cofilin 2 (muscle))

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 166 of Cofilin 2 (muscle) (Uniprot ID#Q9Y281)

Rabbit polyclonal antibody to LIM kinase 2 (LIM domain kinase 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 294 and 638 of LIM kinase 2

Rabbit polyclonal antibody to LIM kinase 2 (LIM domain kinase 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 252 of LIM kinase 2

Rabbit polyclonal anti-DCC antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DCC.

Rabbit polyclonal anti-ROBO-1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat and Dog
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1632-1644 of Human ROBO-1.

Anti-ABL1/ABL2 (phospho-Tyr393/429) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 393/429 (D-T-Y(p)-T-A) derived from Human ABL1/2.
Modifications Phospho-specific

Anti-PAK1 (Phospho-Thr212) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 212 (P-V-T(p)-P-T) derived from Human PAK1.
Modifications Phospho-specific

Mouse monoclonal MET/HGFR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Mouse monoclonal MET/HGFR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal PAK5 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen PAK5 antibody was raised against a 13 amino acid peptide from near the center of human PAK5.

Goat Anti-SRGAP2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KQEDRQTPRSPDST, from the internal region of the protein sequence according to NP_056141.2.

Rabbit polyclonal anti-EPHA6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA6.

Rabbit Polyclonal ROCK1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human ROCK1.

Mouse monoclonal MET/HGFR Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Mouse monoclonal MET/HGFR Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal NFATC4 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NFATC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 744-773 amino acids from the C-terminal region of human NFATC4.

Rabbit Polyclonal NFATC1/NFAT2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Amino acids 264-282 (NKRKYSLNGRQPPYSPHHS) of human NFATc1 were used as immunogen for this antibody.

Rabbit Polyclonal c-Abl Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human c Abl (within residues 700-800). [Swiss-Prot# P00519]

Rabbit Polyclonal Anti-NTN4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NTN4 antibody: synthetic peptide directed towards the N terminal of human NTN4. Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY

Mouse Monoclonal CDK5(N-terminus) Antibody

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated