Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 141 results

Page 1 of 3

(reset)

ADH5 Rabbit Polyclonal Antibody

TA327239

USD 275.00

3 Weeks

Rabbit anti-ADH5 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ADH5

1 / 3

2 / 3

3 / 3

Previous Next

ACAT1 Rabbit Polyclonal Antibody

TA332618

USD 275.00

3 Weeks

Rabbit anti-ACAT1 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ACAT1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

FACL4 (ACSL4) Rabbit Polyclonal Antibody

TA324720

USD 450.00

2 Weeks

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).

1 / 3

2 / 3

3 / 3

Previous Next

ALDH2 Mouse Monoclonal Antibody [Clone ID: 138CT22.3.8]

TA324332

USD 450.00

2 Weeks

Mouse monoclonal ALDH2 Antibody

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody

TA590756

USD 409.00

In Stock

Rabbit Polyclonal FALDH Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

ADH1B Rabbit Polyclonal Antibody

TA324864

USD 450.00

5 Days

Rabbit polyclonal ADH1B Antibody (Center)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ADH7 Rabbit Polyclonal Antibody

TA325109

USD 450.00

5 Days

Rabbit polyclonal ADH7 Antibody (C-Term)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This ADH7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-346 amino acids from the C-terminal region of human ADH7.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALDH2 Rabbit Polyclonal Antibody

TA302017

USD 450.00

2 Weeks

Rabbit Polyclonal Antibody against ALDH2 (N-term)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

1 / 2

2 / 2

Previous Next

Cytochrome P450 4A (CYP4A11) Rabbit Polyclonal Antibody

TA308529

USD 415.00

5 Days

Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928)

1 / 3

2 / 3

3 / 3

Previous Next

ACSL1 Rabbit Polyclonal Antibody

TA319649

USD 430.00

5 Days

Rabbit Polyclonal ACSL1 Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Rabbit polyclonal ACSL1 antibody was raised against an 18 amino acid peptide near the center of human ACSL1. The immunogen is located within amino acids 240 - 290 of ACSL1.

1 / 2

2 / 2

Previous Next

ACADVL Rabbit Polyclonal Antibody

TA334968

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACADVL Antibody

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACADVL antibody: synthetic peptide directed towards the N terminal of human ACADVL. Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ALDH2 Mouse Monoclonal Antibody [Clone ID: OTI4H2]

CF500615

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

CF501216

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

CF501217

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A8]

CF501218

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

CF501219

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

CF501220

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI7B1]

CF501221

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

CF501222

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF501223

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

CF501224

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5A2]

CF501225

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1B7]

CF501238

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI1C3]

CF502775

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI1H7]

CF502776

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI4F12]

CF502777

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat, Dog
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI5D7]

CF502778

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI3C12]

CF502779

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI3C12 (formerly 3C12)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PECI (ECI2) Mouse Monoclonal Antibody [Clone ID: OTI1C8]

CF504275

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PECI mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI1D3]

CF506125

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACAA2 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI1C10]

CF506126

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACAA2 mouse monoclonal antibody, clone OTI1C10 (formerly 1C10)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI1B1]

CF506129

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACAA2 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

CF506154

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACAA2 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI2H2]

CF506155

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACAA2 mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI2G6]

CF506156

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACAA2 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI3C6]

CF506158

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACAA2 mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI3H9]

CF506200

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAA2 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ALDH2 Mouse Monoclonal Antibody [Clone ID: OTI4H2]

TA500615

USD 379.00

In Stock

ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ALDH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H2]

TA500615AM

USD 420.00

4 Weeks

ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2), Biotinylated

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

ALDH2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H2]

TA500615BM

USD 420.00

4 Weeks

ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2), HRP conjugated

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

ALDH2 Mouse Monoclonal Antibody [Clone ID: OTI4H2]

TA500615S

USD 159.00

2 Days

ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

TA501216

USD 379.00

In Stock

ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C5]

TA501216AM

USD 420.00

4 Weeks

ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]

TA501216BM

USD 420.00

4 Weeks

ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

TA501216S

USD 159.00

2 Days

ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA501217

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A11]

TA501217AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A11]

TA501217BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA501217S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A8]

TA501218

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 50 of 141 results

Page 1 of 3