Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%). |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-Melanocortin Receptor 4 (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)HRGMHTSLHLWNRSS, corresponding to amino acid residues 6-20 of human MC4R. Extracellular, N terminal. |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Multiple antigenic peptide (MAP) of an N-terminal synthetic sequence corresponding to amino acids (22–41) of rat 5HT2A receptor. |
Rabbit polyclonal Anti-VPAC1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)EEAQLENETIG(S)SK, corresponding to amino acid residues 52-65 of human VPAC1 (Accession P32241). Extracellular, N-terminus. |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Antibody was raised against a peptide corresponding to amino acids 2 to 21 of human CX3CR1. The sequence differs from those of mouse and rat CX3CR1 by four amino acids (NP_001328). |
Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
| Modifications | Phospho-specific |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
HRH1 / H1 Receptor Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | HRH1 / Histamine H1 Receptor antibody was raised against synthetic peptide CNENFKKTFKRILH from the C-terminus of human HRH1 / Histamine H1 Receptor (NP_000852.1; NP_001091681.1; NP_001091682.1; NP_001091683.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Bat, Platypus (100%); Monkey, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Turkey, Chicken (93%); Marmoset, Guinea pig, Xenopus (86%). |
Rabbit anti-PTH1R Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PTH1R |
Rabbit Polyclonal Anti-Sphingosine 1-Phosphate Receptor 1 (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide SDYVNYDIIVRHYN(C), corresponding to amino acid residues 17-30 of human Sphingosine 1-Phosphate Receptor 1 (S1PR1). Extracellular, N-terminus. |
USD 531.00
In Stock
Active filters
Filter by
Target Symbol
- GPR17 (35)
- LGR5 (20)
- GRM4 (8)
- GRM1 (6)
- CXCR4 (5)
- ADRA1B (4)
- APLNR (4)
- CHRM1 (4)
- GRPR (4)
- HTR2C (4)
- MC4R (4)
- NPY1R (4)
- AGTR2 (3)
- BDKRB2 (3)
- CCR3 (3)
- CXCR3 (3)
- F2R (3)
- GRM3 (3)
- LPAR4 (3)
- P2RY2 (3)
- RXFP3 (3)
- S1PR1 (3)
- ADGRF5 (2)
- ADRA1A (2)
- ADRB3 (2)
- AGTR1 (2)
- BRS3 (2)
- CALCR (2)
- CALCRL (2)
- CCR8 (2)
- CHRM2 (2)
- CX3CR1 (2)
- CXCR2 (2)
- CXCR5 (2)
- DRD3 (2)
- DRD4 (2)
- FPR2 (2)
- FSHR (2)
- FZD1 (2)
- FZD3 (2)
- FZD4 (2)
- GABBR1 (2)
- GLP1R (2)
- GPR3 (2)
- GPR4 (2)
- GRM2 (2)
- GRM7 (2)
- GRM8 (2)
- HCRTR1 (2)
- HTR1F (2)
- HTR2A (2)
- HTR4 (2)
- HTR5A (2)
- HTR7 (2)
- LPAR3 (2)
- MAS1 (2)
- MC5R (2)
- MTNR1A (2)
- OXTR (2)
- P2RY1 (2)
- PTGDR2 (2)
- PTGER3 (2)
- S1PR3 (2)
- S1PR4 (2)
- S1PR5 (2)
- SIGMAR1 (2)
- SSTR1 (2)
- SSTR2 (2)
- SSTR3 (2)
- SSTR4 (2)
- TACR2 (2)
- TSHR (2)
- VIPR1 (2)
- ACKR1 (1)
- ACKR3 (1)
- ADCYAP1R1 (1)
- ADGRB3 (1)
- ADGRG2 (1)
- ADGRL2 (1)
- ADGRL3 (1)
- ADORA1 (1)
- ADORA2B (1)
- ADORA3 (1)
- ADRA2A (1)
- ADRA2C (1)
- ADRB1 (1)
- ADRB2 (1)
- AVPR1B (1)
- AVPR2 (1)
- C3AR1 (1)
- CASR (1)
- CCKBR (1)
- CCR1 (1)
- CCR2 (1)
- CCR5 (1)
- CCR9 (1)
- CHRM3 (1)
- CHRM5 (1)
- CNR2 (1)
- CXCR6 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (196)
- Calcium signaling pathway (70)
- Chemokine signaling pathway (23)
- Cytokine-cytokine receptor interaction (23)
- Gap junction (16)
- Endocytosis (15)
- Regulation of actin cytoskeleton (14)
- Vascular smooth muscle contraction (13)
- Melanogenesis (12)
- Basal cell carcinoma (10)
- Colorectal cancer (10)
- Pathways in cancer (10)
- Wnt signaling pathway (10)
- Taste transduction (8)
- Complement and coagulation cascades (7)
- Long-term depression (7)
- Long-term potentiation (7)
- Renin-angiotensin system (7)
- Axon guidance (5)
- Leukocyte transendothelial migration (5)
- Autoimmune thyroid disease (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Dilated cardiomyopathy (1)
- GnRH signaling pathway (1)
- Huntington's disease (1)
- Olfactory transduction (1)
- Parkinson's disease (1)