Antibodies

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit Polyclonal IFN-beta Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta.

Rabbit Polyclonal Anti-ISG15 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK

Rabbit Polyclonal Anti-IL-12A Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A.

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Interferon beta (IFNB1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly purified (>98%) E.coli derived recombinant Human Inferferon beta.

Anti-Human IP-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IP-10 (CXCL10)

Interferon beta (IFNB1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly purified (>98%) E.coli derived recombinant Human Inferferon beta.

Anti-Human IL-8 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-8 (72 a.a.) (CXCL8)

IL12A rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

IL12B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B.

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

Anti-Human TNF-a Goat Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

Interferon beta (IFNB1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen A 17 amino acid peptide located near the centre of human Interferon beta.

IL8 (CXCL8) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

IL12A goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Canine, Human, Monkey
Immunogen Synthetic peptide from human IL12A / p35

IL12B mouse monoclonal antibody, clone 1-1A4, Purified

Applications ELISA, IHC
Reactivities Human

Goat Polyclonal Antibody against IL12B / IL12p40

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGKSKREKKDRVFTD, from the internal region of the protein sequence according to NP_002178.2.

Rabbit Polyclonal antibody to interferon alpha 8 (interferon, alpha 8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 189 of interferon alpha 8 (Uniprot ID#P32881)

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

Rabbit Polyclonal TNF-alpha Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor

Rabbit Polyclonal Anti-IFNA16 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IFNA16

Rabbit Polyclonal Anti-IFNA2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IFNA2

Rabbit Polyclonal Anti-IL12A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL12A

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)

Applications IHC
Reactivities Human
Conjugation Unconjugated

IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9), Biotinylated

Applications IHC
Reactivities Human
Conjugation Biotin

IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9), HRP conjugated

Applications IHC
Reactivities Human
Conjugation HRP

IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)

Applications IHC
Reactivities Human
Conjugation Unconjugated

TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated