Rabbit anti-IRF3 Polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IRF3 |
Rabbit anti-IRF3 Polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IRF3 |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-IRF3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRF3 |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
Modifications | Phospho-specific |
Mouse monoclonal NF-kB p65 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-NFKBIB Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NFKBIB |
Mouse Monoclonal RelA/NFkB p65 Antibody (112A1021)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-IKBKG Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKG |
Rabbit Polyclonal IRF7 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7. |
Rabbit Polyclonal NFkB1/NFkB p105 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838] |
Rabbit polyclonal NFkB p65 phospho S536 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding S536 of human p65 (RelA) protein. |
IKBKB Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human IKBKB |
Rabbit polyclonal NF-kB p105/p50 (Ser893) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NF-?B p105/p50 around the phosphorylation site of serine 893. |
Modifications | Phospho-specific |
Mouse Monoclonal IKK beta Antibody (10AG2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
NF-kB p65 (RELA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 400-450 of Human NFkB-p65. |
NFKB1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide, corresponding to amino acids 900-950 of Human NFkB-p105. |
NF-kB p65 (RELA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal IRF3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | IRF3 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy-terminus of human IRF3. |
Rabbit Polyclonal POLR3F Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | POLR3F antibody was raised against a 21 amino acid peptide from near the amino terminus of human POLR3F. |
Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920) |
Rabbit polyclonal IKK-gamma (Ser376) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 376 (Y-L-SP-S-P). |
Modifications | Phospho-specific |
Rabbit polyclonal NF-kB p65(Ab-276) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human NF-?B p65 around the phosphorylation site of Serine 276. |
Rabbit polyclonal NF-kB p65 (Ser281) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NF-kB p65 around the phosphorylation site of serine 281 (E-L-SP-E-P) |
Modifications | Phospho-specific |
Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Ser23, Mouse: Ser23, Rat: Ser23 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23. |
Modifications | Phospho-specific |
Mouse Monoclonal NFkB p105/p50 Antibody (2J10D7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NF-kB p65 (RELA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 220-270 of Human NFkB-p65. |
NF-kB p65 (RELA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 450-500 of Human NFkB-p65. |
IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
NF-kB p65 (RELA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
NFKB1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
NF-kB p65 (RELA) pSer529 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
NF-kB p65 (RELA) pSer536 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
POLR3A rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
POLR3F (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, POLR3F antibody was raised against a 21 amino acid peptide from near the amino terminus of human POLR3F. |
Rabbit Polyclonal IRF7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the center of human IRF7. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser907) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NF-κBp105/p50 around the phosphorylation site of serine 907 (P-L-SP-P-A). |
Modifications | Phospho-specific |
Rabbit polyclonal IKK-gamma (Ab-31) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 31 (E-E-SP- P-L). |
Rabbit polyclonal IKK-gamma (Ser31) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 31 (E-E-SP-P-L). |
Modifications | Phospho-specific |
Rabbit polyclonal NF-kB p65 (Ser529) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human NF-?B p65 around the phosphorylation site of serine 529 (L-L-SP-G-D). |
Modifications | Phospho-specific |
Rabbit polyclonal NFkB p65 (RelA) Phospho S276 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | NFkB p65 (Rel A) peptide corresponding to a region near phospho Serine 276 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). Sequence information: QLRRPpSDRELSC |
Rabbit polyclonal anti-NFkB p65 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with the NFkB p65 peptide corresponding to the NLS of the human protein conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Rabbit polyclonal NFkB p65 (RelA) Phospho S529 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | NFkB p65 (Rel A) peptide corresponding to a region near phospho Serine 529 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal anti-NFKB p65 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NFkB p65 (Rel A) peptide corresponding to a region near the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal anti-IKK beta antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IKKb peptide corresponding to the highly conserved C-terminus region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Anti-POLR1C Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 200 amino acids of human polymerase (RNA) I polypeptide C, 30kDa |
Rabbit Polyclonal NF-?B p65 (Ser311) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human NF-?B p65 around the phosphorylation site of Sersine 311 |
Modifications | Phospho-specific |
Rabbit Polyclonal NF-?B p65 (Ser536) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human NF-?B p65 around the phosphorylation site of Sersine 536 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFKBIB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV |