Germany
Japan
United Kingdom
China
Anti-CASP3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 485-499 of Human caspase 3, apoptosis-related cysteine peptidase |
Antibodies
View as table Download
Anti-CDK6 (phospho-Tyr24) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 24 (G-A-Y(p)-G-K) derived from Human CDK6. |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP3 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 219-248 amino acids from the C-terminal region of human CASP3. |
Rabbit polyclonal Maspin Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Maspin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 94-123 amino acids from the Central region of human Maspin. |
Rabbit polyclonal Phospho-p53(T18) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Apaf1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Apaf1 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human Apaf1. The sequence of the immunogenic peptide differs from that of murine Apaf1 by one amino acid . |
Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Chk2 (Thr68) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of Threonine 68 (V-S-TP-Q-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal PTEN(Ab-380/382/383) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383. |
Rabbit polyclonal anti-cdk2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CCND3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCND3 antibody: synthetic peptide directed towards the C terminal of human CCND3. Synthetic peptide located within the following region: CQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL |
Rabbit Polyclonal Anti-SIAH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the N terminal of human SIAH1. Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA |
Rabbit anti-ATM (Phospho-Ser1981) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanATM around the phosphorylation site of serine 1981 (E-G-SP-Q-S). |
| Modifications | Phospho-specific |
Rabbit anti-THBS1 polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal THBS1 antibody was raised against a peptide from near the N terminal residues of human THBS1 protein. |
Rabbit polyclonal anti-BAX antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal TSC2 (Tyr1571) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TSC2 around the phosphorylation site of tyrosine 1571 (Y-R-YP-T-E). |
| Modifications | Phospho-specific |
Anti-CASP9 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-CASP9 (active) Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 41-56 amino acids of human caspase 9, apoptosis-related cysteine peptidase |
Anti-CCNE1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 398-410 amino acids of Human Cyclin E1 |
Anti-CDK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1 |
Anti-BBC3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 180-193 amino acids of Human Bcl-2-binding component 3 |
Anti-CCND1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1 |
Anti-APAF1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 11-25 amino acids of Human Apoptotic protease-activating factor 1 |
Anti-APAF1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 8-20 amino acids of Human apoptotic peptidase activating factor 1 |
Anti-GADD45G Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-CCNB2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 45-58 amino acids of Human cyclin B2 |
Anti-CASP3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase |
Anti-SERPINB5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- IHC
Isotypes
- IgG
Pathways
- p53 signaling pathway
Filter by
Target Symbol
- BAX (8)
- CASP3 (7)
- PTEN (7)
- APAF1 (6)
- CASP9 (6)
- CCNB1 (5)
- CDK6 (5)
- TP53 (5)
- CCND3 (4)
- CCNE1 (4)
- BID (3)
- CCND1 (3)
- CDK1 (3)
- CDKN1A (3)
- CHEK2 (3)
- CYCS (3)
- SERPINB5 (3)
- SIAH1 (3)
- THBS1 (3)
- TP73 (3)
- TSC2 (3)
- ADGRB1 (2)
- CCNB2 (2)
- CCND2 (2)
- CDK2 (2)
- CDKN2A (2)
- EI24 (2)
- GADD45A (2)
- GADD45B (2)
- GADD45G (2)
- SESN2 (2)
- SFN (2)
- ATM (1)
- BBC3 (1)
- CCNG1 (1)
- CD82 (1)
- CDK4 (1)
- FAS (1)
- IGF1 (1)
- IGFBP3 (1)
- MDM2 (1)
- MDM4 (1)
- PMAIP1 (1)
- RCHY1 (1)
- RRM2 (1)
- RRM2B (1)
- SERPINE1 (1)
- SESN1 (1)
- SESN3 (1)
- STEAP3 (1)
- TNFRSF10B (1)
- TP53AIP1 (1)
- ZMAT3 (1)
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (125)
- Stem cell - Pluripotency (35)
- Transcription Factors (16)
- Transmembrane (16)
- Protein Kinase (15)
- Protease (13)
- ES Cell Differentiation/IPS (9)
- Secreted Protein (9)
- Phosphatase (7)
- Stem cell relevant signaling - DSL/Notch pathway (7)
- Stem cell relevant signaling - JAK/STAT signaling pathway (3)
- Stem cell relevant signaling - Wnt Signaling pathway (3)