Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against SR-BI
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mink, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A C-terminal peptide containing residues from mouse Scavenger Receptor-BI (within residues 450-509). |
Rabbit polyclonal HIF1A Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Hamster |
Conjugation | Unconjugated |
Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Gorilla, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
GNAT3 / Gustducin Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | GNAT3 / Gustducin antibody was raised against synthetic peptide C-KNQFLDLNLKKEDKE from an internal region of human GNAT3 (NP_001095856.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Bat, Lizard (93%); Platypus (87%); Turkey, Chicken (80%). |
FSP1 / S100A4 Goat Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | S100A4 / FSP1 antibody was raised against synthetic peptide CNEFFEGFPDKQP from the C-terminus of human S100A4 / FSP1 (NP_002952.1; NP_062427.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Marmoset, Hamster, Elephant, Bat (92%); Mouse, Rat (85%). |
Rabbit Polyclonal Calnexin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Mouse monoclonal Hsp60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Hamster, Monkey, Pig, Rabbit, Spinach, E.coli (GroEl), H. pylori, S. typhimurium, T. spiralis, yeast, white fly |
Conjugation | Unconjugated |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Horse, Human, Monkey, Pig |
Conjugation | Unconjugated |
Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
Rabbit Polyclonal Niemann-Pick C1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast |
Conjugation | Unconjugated |
NOS1 (1419-1433) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Optineurin Rabbit Polyclonal (aa575-591) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | OPTN / Optineurin antibody was raised against synthetic peptide corresponding to aa 559-575 (GEVLPDIDTLQIHVMDC) of human, mouse and rat optineurin |
HRH1 / H1 Receptor Goat Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | HRH1 / Histamine H1 Receptor antibody was raised against synthetic peptide CNENFKKTFKRILH from the C-terminus of human HRH1 / Histamine H1 Receptor (NP_000852.1; NP_001091681.1; NP_001091682.1; NP_001091683.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Bat, Platypus (100%); Monkey, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Turkey, Chicken (93%); Marmoset, Guinea pig, Xenopus (86%). |
Rabbit polyclonal Vimentin Antibody (S82)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-90 amino acids from human Vimentin. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Hamster |
Conjugation | Unconjugated |
Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Mouse monoclonal Hsp70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Canine, Chicken, Drosophilia, Carp, Guinea pig, Hamster, Monkey, Pig, Rabbit, Sheep |
Conjugation | Unconjugated |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
Conjugation | Unconjugated |
Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Mouse Monoclonal Actin Antibody (mAbGEa)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Hamster, Drosophila |
Conjugation | Unconjugated |
Mouse Monoclonal HP1-gamma Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Hamster, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal HP1-gamma Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Hamster, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Antibody against DRP1
Applications | IHC |
Reactivities | Human, Primate, Mouse, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region within residues 500-600 of the human protein. [Swiss-Prot# O00429] |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Anti-Hepsin Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Orang-Utan, Rabbit |
Conjugation | Unconjugated |
Immunogen | HPN / TMPRSS1 / Hepsin antibody was raised against human hepsin amino acids 241-260 (GGYLPFRDPNSEENSNDIAL). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Panda, Rabbit (100%); Opossum (95%); Hamster, Horse (90%); Mouse, Rat (85%); Xenopus (80%). |
Anti-IGFBP-5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%). |
INPP5J / PIB5PA Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | INPP5J / PIB5PA antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Platypus (83%). |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
ZIP14 / SLC39A14 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Chimpanzee, Dog, Gorilla, Horse, Human, Pig |
Conjugation | Unconjugated |
Immunogen | SLC39A14 / ZIP14 antibody was raised against synthetic 15 amino acid peptide from internal region of human SLC39A14. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Panda, Dog, Bat, Horse, Pig (100%); Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Hamster, Bovine (93%); Elephant (87%); Rat, Rabbit, Guinea pig (80%). |
ZIP14 / SLC39A14 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan, Pig |
Conjugation | Unconjugated |
Immunogen | SLC39A14 / ZIP14 antibody was raised against synthetic 15 amino acid peptide from cytoplasmic domain of human SLC39A14. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Pig (100%); Bovine, Dog, Hamster, Elephant, Panda (93%); Rat, Bat, Rabbit, Horse, Opossum (87%); Mouse (80%). |
WNT2B Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
Conjugation | Unconjugated |
Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
SLC22A17 Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
Conjugation | Unconjugated |
Immunogen | SLC22A17 antibody was raised against synthetic peptide C-PETKRKLLPEVLRD from an internal region of human SLC22A17 (NP_065105.2; NP_057693.3). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bat, Bovine, Horse, Pig (100%); Elephant, Rabbit (93%). |
UCP2 Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Xenopus, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | UCP2 antibody was raised against synthetic peptide C-DSVKQFYTKGSEH from an internal region of human UCP2 (NP_003346.2). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Xenopus, Stickleback (100%); Smelt, Zebrafish (92%); Trout, Salmon (85%). |
SCG10 / STMN2 Goat Polyclonal Antibody
Applications | IHC |
Reactivities | Bovine, Chicken, Dog, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | SCG10 / STMN2 antibody was raised against synthetic peptide AKTAMAYKEK-C from the N-terminus of human STMN2 (NP_008960.2). Percent identity by BLAST analysis: Human, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Turkey, Chicken (100%); Xenopus, Stickleback, Zebrafish (90%); Water flea, Poplar, Arabidopsis (80%). |
Anti-ROR1 Goat Polyclonal () Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | ROR1 antibody was raised against synthetic peptide C-GNKSQKPYKIDSKQA from the C-terminus (near) of human ROR1 (NP_005003.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Lizard (93%); Turkey, Chicken (87%); Platypus (80%). |
DOK3 Goat Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DOK3 antibody was raised against synthetic peptide TRERRKGPAPCDRP from the C-terminus of human DOK3 (NP_079148.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Rabbit (93%); Bovine, Bat (86%). |
Rabbit polyclonal COPE Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This COPE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-300 amino acids from the C-terminal region of human COPE. |
Rabbit polyclonal PCYT1A Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCYT1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-54 amino acids from the N-terminal region of human PCYT1A. |
Rabbit polyclonal TSN Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This TSN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human TSN. |
Rabbit polyclonal Vimentin Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 430-457 amino acids from the C-terminal region of human Vimentin. |
Rabbit polyclonal PCNA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-KCNQ1 Antibody
Applications | IHC, WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Abcc8 mouse monoclonal antibody, clone N289/16
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Abcc8 mouse monoclonal antibody, clone N289/16
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-UBB Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
Conjugation | Unconjugated |
Immunogen | Native bovine Ubiquitin, conjugated to KLH |