Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit Polyclonal Anti-MGP
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGP antibody: synthetic peptide directed towards the middle region of human MGP. Synthetic peptide located within the following region: INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit Polyclonal Anti-PTHLH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
Rabbit Polyclonal VGF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VGF antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of the human VGF. The immunogen is located within the last 50 amino acids of VGF. |
Chicken Polyclonal Albumin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Albumin antibody was raised against a 13 amino acid synthetic peptide near the center of human Albumin. The immunogen is located within amino acids 340 - 390 of Albumin. |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Rabbit polyclonal FOLR1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOLR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-68 amino acids from the N-terminal region of human FOLR1. |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
Rabbit polyclonal CMGA Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CMGA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 376-404 amino acids from the C-terminal region of human CMGA. |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Mouse Monoclonal MUC 1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-VTN Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 141-154 amino acids of human vitronectin |
Anti-PLAT Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue |
Anti-KLK5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 279-293 amino acids of Human kallikrein-related peptidase 5 |
Anti-SV2A Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 21-35 amino acids of human synaptic vesicle glycoprotein 2A |
Anti-SERPINB5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-TNFRSF11B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 195-365 amino acids of human tumor necrosis factor receptor superfamily, member 11b |
Anti-SERPINA3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3 |
Anti-AACT Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 290-303 amino acids of Human Alpha-1-antichymotrypsin |
Anti-GAS6 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 690-705 amino acids of Human growth arrest-specific 6 |
Anti-SPP1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 17-300 amino acids of human secreted phosphoprotein 1 |
Anti-ADAMDEC1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 206-340 amino acids of human ADAM-like, decysin 1 |
Anti-KLK7 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 30-253 amino acids of human kallikrein-related peptidase 7kallikrein-related peptidase 7 |
Anti-SYT7 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 54-200 amino acids of human synaptotagmin VII |
Rabbit Polyclonal Anti-WNT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WNT2 |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Families
- Secreted Protein
Citations
- Yes
Filter by
Category
Target Symbol
- CHGA (5)
- CCN2 (4)
- CD163 (4)
- CD8A (4)
- SPP1 (4)
- FGF2 (3)
- IL1B (3)
- LAMB3 (3)
- ADIPOQ (2)
- APOE (2)
- BDNF (2)
- CD40 (2)
- DPP4 (2)
- EGFR (2)
- FGFR2 (2)
- FN1 (2)
- IL6 (2)
- LECT2 (2)
- LGALS3BP (2)
- LOXL2 (2)
- NTF3 (2)
- POSTN (2)
- SERPINA1 (2)
- SERPINA3 (2)
- SERPINB3 (2)
- SERPINE2 (2)
- SIL1 (2)
- SYP (2)
- TIMP2 (2)
- VWF (2)
- WFDC2 (2)
- ADAMDEC1 (1)
- ADAMTS1 (1)
- ADAMTS5 (1)
- ALB (1)
- BMP4 (1)
- DBH (1)
- DCN (1)
- FOLR1 (1)
- GAS6 (1)
- IFNB1 (1)
- IL17RB (1)
- IL18 (1)
- IL33 (1)
- ISG15 (1)
- KLK5 (1)
- KLK7 (1)
- LIF (1)
- LOX (1)
- MGP (1)
- MUC1 (1)
- NGF (1)
- PLAT (1)
- PLAUR (1)
- PTHLH (1)
- SCGB1A1 (1)
- SERPINB5 (1)
- SERPINE1 (1)
- SLPI (1)
- ST6GAL1 (1)
- SV2A (1)
- SYT7 (1)
- TFF1 (1)
- TIMP1 (1)
- TNFRSF11B (1)
- VGF (1)
- VIP (1)
- VTN (1)
- WNT2 (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Pathways
- Pathways in cancer (16)
- MAPK signaling pathway (15)
- Cytokine-cytokine receptor interaction (14)
- Focal adhesion (14)
- ECM-receptor interaction (13)
- Toll-like receptor signaling pathway (12)
- Hematopoietic cell lineage (9)
- Regulation of actin cytoskeleton (9)
- Cytosolic DNA-sensing pathway (8)
- Complement and coagulation cascades (7)
- Cell adhesion molecules (CAMs) (6)
- NOD-like receptor signaling pathway (6)
- Primary immunodeficiency (6)
- Alzheimer's disease (5)
- Graft-versus-host disease (5)
- Melanoma (5)
- Neurotrophin signaling pathway (5)
- Prion diseases (5)
- Small cell lung cancer (5)
- Antigen processing and presentation (4)
- Apoptosis (4)
- Endocytosis (4)
- Jak-STAT signaling pathway (4)
- Prostate cancer (4)
- T cell receptor signaling pathway (4)
- Type I diabetes mellitus (3)
- Adherens junction (2)
- Adipocytokine signaling pathway (2)
- Allograft rejection (2)
- Asthma (2)
- Autoimmune thyroid disease (2)
- Basal cell carcinoma (2)
- Bladder cancer (2)
- Calcium signaling pathway (2)
- Colorectal cancer (2)
- Dorso-ventral axis formation (2)
- Endometrial cancer (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- ErbB signaling pathway (2)
- Gap junction (2)
- Glioma (2)
- GnRH signaling pathway (2)
- Hedgehog signaling pathway (2)
- Huntington's disease (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Metabolic pathways (2)
- Non-small cell lung cancer (2)
- PPAR signaling pathway (2)
- Pancreatic cancer (2)
- RIG-I-like receptor signaling pathway (2)
- Systemic lupus erythematosus (2)
- TGF-beta signaling pathway (2)
- Type II diabetes mellitus (2)
- Viral myocarditis (2)
- p53 signaling pathway (2)
- Melanogenesis (1)
- N-Glycan biosynthesis (1)
- Natural killer cell mediated cytotoxicity (1)
- Tyrosine metabolism (1)
- Wnt signaling pathway (1)