Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-GABRA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Calneuron-1 / CALN1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Calneuron-1 / CALN1 antibody was raised against a 16 amino acid peptide near the amino terminus of human CaBP8. |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal Antibody against BCL2L2
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Bcl antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-59 amino acids from human Bcl. |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Active filters
Reactivities
- Mouse
Applications
- IHC
Families
- Transmembrane
Citations
- Yes
Filter by
Category
Target Symbol
- LGR5 (7)
- CDH2 (5)
- BAX (4)
- SLC7A8 (4)
- BCL2 (3)
- ERBB2 (3)
- MME (3)
- NCAM1 (3)
- SLC18A2 (3)
- TMEM100 (3)
- ABCC4 (2)
- ABCG2 (2)
- APMAP (2)
- AQP1 (2)
- B3GNT2 (2)
- BCL2L1 (2)
- BDNF (2)
- CYP2A6 (2)
- DPP4 (2)
- DPP8 (2)
- EGFR (2)
- FBXW7 (2)
- FGFR2 (2)
- FGFR3 (2)
- L1CAM (2)
- MET (2)
- MS4A1 (2)
- NPR3 (2)
- NTRK1 (2)
- NTRK2 (2)
- PTCH1 (2)
- PTPRE (2)
- ROMO1 (2)
- SDCBP (2)
- SIL1 (2)
- SYP (2)
- TGFBR2 (2)
- UBE2J1 (2)
- ABCC5 (1)
- ADAM10 (1)
- ADCY1 (1)
- ANPEP (1)
- ANTXR1 (1)
- AQP4 (1)
- BCL2L2 (1)
- CALN1 (1)
- CANX (1)
- CAV1 (1)
- CD274 (1)
- CD276 (1)
- CD4 (1)
- CDH5 (1)
- CHRM1 (1)
- CHSY1 (1)
- CX3CR1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- CYP8B1 (1)
- DDR1 (1)
- DIABLO (1)
- DPAGT1 (1)
- FAIM2 (1)
- GABRA5 (1)
- GP9 (1)
- GPD2 (1)
- GPER1 (1)
- GPR183 (1)
- HAVCR1 (1)
- HMOX1 (1)
- IFNB1 (1)
- IGF1R (1)
- ITGA6 (1)
- ITGAX (1)
- ITGB6 (1)
- KDR (1)
- KLK5 (1)
- LAMP1 (1)
- LTBR (1)
- MTNR1A (1)
- NECTIN1 (1)
- NPC1L1 (1)
- NPHS1 (1)
- NPHS2 (1)
- P2RX1 (1)
- PDCD1 (1)
- PECAM1 (1)
- PRNP (1)
- RHBDD2 (1)
- S1PR3 (1)
- SCARB1 (1)
- SDC4 (1)
- SEMA3D (1)
- SIGMAR1 (1)
- SLC16A1 (1)
- SLC17A6 (1)
- SLC17A7 (1)
- SLC22A6 (1)
- SLC22A8 (1)
- SLC2A1 (1)
- SLC44A1 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (29)
- Cell adhesion molecules (CAMs) (19)
- Focal adhesion (15)
- Colorectal cancer (14)
- Endocytosis (14)
- MAPK signaling pathway (14)
- Neurotrophin signaling pathway (13)
- Adherens junction (11)
- Apoptosis (11)
- Prostate cancer (11)
- Calcium signaling pathway (10)
- Cytokine-cytokine receptor interaction (10)
- Metabolic pathways (10)
- Regulation of actin cytoskeleton (10)
- Amyotrophic lateral sclerosis (ALS) (9)
- Hematopoietic cell lineage (9)
- Pancreatic cancer (9)
- Prion diseases (8)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (7)
- Bladder cancer (7)
- Huntington's disease (7)
- Neuroactive ligand-receptor interaction (6)
- Parkinson's disease (6)
- Small cell lung cancer (6)
- ABC transporters (5)
- Axon guidance (5)
- ECM-receptor interaction (5)
- Endometrial cancer (5)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- ErbB signaling pathway (5)
- Melanoma (5)
- Non-small cell lung cancer (5)
- Alzheimer's disease (4)
- Chronic myeloid leukemia (4)
- Renin-angiotensin system (4)
- Ubiquitin mediated proteolysis (4)
- p53 signaling pathway (4)
- Dilated cardiomyopathy (3)
- Drug metabolism - cytochrome P450 (3)
- Drug metabolism - other enzymes (3)
- Gap junction (3)
- Glioma (3)
- GnRH signaling pathway (3)
- Jak-STAT signaling pathway (3)
- Renal cell carcinoma (3)
- Retinol metabolism (3)
- Toll-like receptor signaling pathway (3)
- Antigen processing and presentation (2)
- Basal cell carcinoma (2)
- Caffeine metabolism (2)
- Chemokine signaling pathway (2)
- Dorso-ventral axis formation (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Hedgehog signaling pathway (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Keratan sulfate biosynthesis (2)
- Leukocyte transendothelial migration (2)
- Oocyte meiosis (2)
- PPAR signaling pathway (2)
- Primary bile acid biosynthesis (2)
- Progesterone-mediated oocyte maturation (2)
- T cell receptor signaling pathway (2)
- TGF-beta signaling pathway (2)
- Thyroid cancer (2)
- Adipocytokine signaling pathway (1)
- Chondroitin sulfate biosynthesis (1)
- Cytosolic DNA-sensing pathway (1)
- Glutathione metabolism (1)
- Glycerophospholipid metabolism (1)
- Linoleic acid metabolism (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysosome (1)
- Melanogenesis (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- N-Glycan biosynthesis (1)
- Natural killer cell mediated cytotoxicity (1)
- Pathogenic Escherichia coli infection (1)
- Porphyrin and chlorophyll metabolism (1)
- Primary immunodeficiency (1)
- Purine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Viral myocarditis (1)