Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal NeuroD1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit Polyclonal Antibody against CD14 (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS |
Rabbit Polyclonal Antibody against CD14 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14. |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Anti-ERBB3 (phospho-Tyr1328) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1328 (P-D-Y(p)-W-H) derived from Human Her3/ErbB3. |
| Modifications | Phospho-specific |
Rabbit polyclonal PAX3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3. |
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Adult stem cells
Filter by
Category
Target Symbol
- BDNF (9)
- EGFR (8)
- SOX2 (8)
- ERBB3 (6)
- GATA3 (6)
- HDAC1 (6)
- NOTCH1 (6)
- KLF4 (5)
- CD44 (4)
- HNF1A (4)
- MAP2 (4)
- PAX3 (4)
- WNT1 (4)
- WNT3A (4)
- CD8A (3)
- CDX2 (3)
- EGF (3)
- FGF4 (3)
- FGF7 (3)
- GATA1 (3)
- GLI3 (3)
- POU5F1 (3)
- SFRP1 (3)
- ADGRE5 (2)
- APOE (2)
- BMP15 (2)
- BMP2 (2)
- BMP4 (2)
- BMP7 (2)
- CD14 (2)
- CD9 (2)
- GDF3 (2)
- GLI2 (2)
- HGF (2)
- IGFBP1 (2)
- KIT (2)
- LEF1 (2)
- PAX7 (2)
- SMURF2 (2)
- SOX10 (2)
- SOX9 (2)
- WNT2 (2)
- WNT5A (2)
- WNT6 (2)
- BMP6 (1)
- CCN4 (1)
- CD4 (1)
- DKK1 (1)
- DKK2 (1)
- DKK4 (1)
- FGF10 (1)
- FGF21 (1)
- GATA2 (1)
- GDF9 (1)
- GLI1 (1)
- HES1 (1)
- IGFBP2 (1)
- LIF (1)
- NEUROD1 (1)
- PDGFC (1)
- SFRP4 (1)
- SFRP5 (1)
- WNT7B (1)
Reactivities
- Human (165)
- Mouse (110)
- Rat (76)
- Bovine (8)
- Chicken (6)
- Dog (6)
- Pig (6)
- Primate (5)
- Cow (4)
- Monkey (4)
- Rabbit (4)
- Bat (2)
- Feline (2)
- Hamster (2)
- Sheep (2)
- Xenopus (2)
- Canine (1)
- Canis (1)
- Chimpanzee (1)
- Gibbon (1)
- Goat (1)
- Gorilla (1)
- Guinea Pig (1)
- Horse (1)
- Macaque (1)
- Porcine (1)
- Quail (1)
- X. tropicalis (1)
- Zebrafish (1)
Antibody Hosts
Modifications
Pathways
- Pathways in cancer (56)
- MAPK signaling pathway (30)
- Hedgehog signaling pathway (28)
- Basal cell carcinoma (27)
- Wnt signaling pathway (25)
- Endocytosis (23)
- Melanoma (22)
- Regulation of actin cytoskeleton (22)
- Cytokine-cytokine receptor interaction (21)
- Melanogenesis (21)
- ErbB signaling pathway (17)
- Hematopoietic cell lineage (16)
- Huntington's disease (15)
- Calcium signaling pathway (14)
- Dorso-ventral axis formation (14)
- Focal adhesion (14)
- Prostate cancer (14)
- Endometrial cancer (13)
- Notch signaling pathway (13)
- Gap junction (12)
- Bladder cancer (11)
- Glioma (11)
- Non-small cell lung cancer (11)
- Pancreatic cancer (11)
- Adherens junction (10)
- Colorectal cancer (10)
- Neurotrophin signaling pathway (9)
- TGF-beta signaling pathway (9)
- Epithelial cell signaling in Helicobacter pylori infection (8)
- GnRH signaling pathway (8)
- Acute myeloid leukemia (6)
- Antigen processing and presentation (6)
- Cell adhesion molecules (CAMs) (6)
- Cell cycle (6)
- Chronic myeloid leukemia (6)
- Maturity onset diabetes of the young (6)
- Prion diseases (6)
- ECM-receptor interaction (4)
- Primary immunodeficiency (4)
- T cell receptor signaling pathway (4)
- Allograft rejection (2)
- Alzheimer's disease (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Autoimmune thyroid disease (2)
- Graft-versus-host disease (2)
- Pathogenic Escherichia coli infection (2)
- Renal cell carcinoma (2)
- Thyroid cancer (2)
- Toll-like receptor signaling pathway (2)
- Type I diabetes mellitus (2)
- Ubiquitin mediated proteolysis (2)
- Viral myocarditis (2)
- Jak-STAT signaling pathway (1)