TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584] |
Rabbit anti-CYCS Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYCS |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
CASP7 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CASP7 |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CASP3 |
Rabbit Polyclonal Anti-BAD Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BAD |
Rabbit Polyclonal Anti-APP Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APP |
Rabbit Polyclonal Anti-NOS2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NOS2 |
Rabbit anti-TNF-R1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNF-R1 |
Rabbit Polyclonal Anti-SNRPN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SNRPN antibody was raised against a 20 amino acid peptide near the amino terminus of human SNRPN. |
PLCB1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLCB1 |
Rabbit anti-HSD17B10 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSD17B10 |
IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta |
Rabbit polyclonal anti-iNOS antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human iNOS. |
Rabbit Polyclonal CD10 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal CDK5 (Ab-15) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDK5 around the phosphorylation site of tyrosine 15 (G-T-YP-G-T) |
Rabbit polyclonal APAF-1-ALT antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human APAF-1-ALT. |
Rabbit anti-CAPN1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CAPN1 |
Rabbit Polyclonal Anti-LRP1 Antibody - middle region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR |
Rabbit Polyclonal Presenilin1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1. |
Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Rabbit Polyclonal Anti-ATP2A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit Polyclonal APP Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APP antibody was raised against an 18 amino acid peptide near the amino terminus of human APP. |
Rabbit polyclonal p44/42 MAPK antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human ERK1/2. |
PEN2 (PSENEN) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | PSENEN antibody was raised against synthetic peptide - KLH conjugated |
Cytochrome C (CYCS) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Cytochrome C |
ATP5A (ATP5A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide from Human ATP5A1 protein (aa 201-250). |
NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A. |
Rabbit Polyclonal APH1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APH1 antibody was raised against a 18 amino acid peptide from near the center of human APH1. |
Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P). |
Modifications | Phospho-specific |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
Modifications | Phospho-specific |
Rabbit polyclonal PEK/PERK (Thr981) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PEK/PERK around the phosphorylation site of threonine 981 (R-H-TP-G-Q). |
Modifications | Phospho-specific |
Rabbit polyclonal Neprilysin Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit polyclonal Amyloid β A4 (Phospho-Thr743/668) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Amyloid β A4 around the phosphorylation site of threonine 743 (A-V-TP-P-E) |
Modifications | Phospho-specific |
APP Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human APP |
Rabbit anti-MME Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MME |
Rabbit Polyclonal Caspase 7 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
p35 (CDK5R1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 1-54 of Human p35. |
Caspase 9 (CASP9) (299-318) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Akirin1 antibody was raised against peptide corresponding to aa 299-318 of the human Caspase 9. |
NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1 |
Tau (MAPT) chicken polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Antipeptide antibodies were generated in chickens against two sequences shared between the Mouse (P10637.3) and Human (P10636.5) gene products. Neither of these sequences contain phosphorylated serine or threonine residues, so these tau antibodies recognize both the euphosphorylated and hyperphosphorylated forms of Tau. Production: After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 0.2 mg/ml. Finally, equal volumes of both of these affinity-purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized. |
TNFRSF1A (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human TNFRSF1A |
Rabbit Polyclonal BACE2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BACE2 antibody was raised against a synthetic peptide corresponding to amino acids 44 to 59 of human BACE2. |
Rabbit polyclonal Synuclein-pan antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human synuclein. |
Rabbit polyclonal FADD (Ser191) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FADD around the phosphorylation site of serine 191 (N-M-SP-P-V). |
Modifications | Phospho-specific |
Rabbit polyclonal Caspase 7 (Cleaved-Asp198) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CASP7. |