Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified Collagen type I from Human skin. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Focal adhesion
Filter by
Category
Target Symbol
- AKT1 (29)
- EGFR (23)
- COL1A1 (21)
- PAK1 (19)
- BAD (16)
- KDR (16)
- SRC (15)
- CTNNB1 (14)
- MAP2K1 (13)
- VASP (12)
- EGF (11)
- ERBB2 (11)
- JUN (11)
- PDGFRB (11)
- PTK2 (11)
- BRAF (10)
- RAF1 (10)
- BCL2 (9)
- COL5A1 (9)
- PIK3R1 (9)
- PXN (9)
- GSK3B (8)
- MAPK8 (8)
- PRKCA (8)
- AKT2 (7)
- ITGA6 (7)
- PDGFB (7)
- ROCK2 (7)
- SPP1 (7)
- AKT3 (6)
- GRB2 (6)
- IGF1 (6)
- MET (6)
- PDGFA (6)
- PTEN (6)
- VEGFA (6)
- BCAR1 (5)
- ELK1 (5)
- IGF1R (5)
- ILK (5)
- ITGB3 (5)
- PAK2 (5)
- SHC1 (5)
- CCND1 (4)
- CCND3 (4)
- CRK (4)
- CRKL (4)
- FLT1 (4)
- FYN (4)
- ITGA4 (4)
- ITGB1 (4)
- MAPK1 (4)
- PDPK1 (4)
- PIK3CG (4)
- ROCK1 (4)
- THBS1 (4)
- VWF (4)
- XIAP (4)
- ACTN1 (3)
- ACTN4 (3)
- BIRC2 (3)
- CAV1 (3)
- CAV2 (3)
- CAV3 (3)
- COL1A2 (3)
- COL3A1 (3)
- FN1 (3)
- ITGA2 (3)
- ITGB4 (3)
- LAMA1 (3)
- LAMA4 (3)
- LAMB3 (3)
- MAPK3 (3)
- MYLK3 (3)
- PAK3 (3)
- PAK5 (3)
- PAK6 (3)
- PDGFRA (3)
- PGF (3)
- PIK3CA (3)
- PIK3CD (3)
- PPP1CB (3)
- TNXB (3)
- VCL (3)
- VTN (3)
- BIRC3 (2)
- CCND2 (2)
- COL5A2 (2)
- DOCK1 (2)
- HGF (2)
- HRAS (2)
- ITGA2B (2)
- ITGA3 (2)
- ITGA7 (2)
- ITGAV (2)
- LAMA3 (2)
- LAMA5 (2)
- LAMB1 (2)
- MAPK9 (2)
- PAK4 (2)